KEGG   Burkholderia mallei ATCC 23344: BMA0887Help
Entry
BMA0887           CDS       T00204                                 

Definition
di-heme cytochrome c peroxidase family protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bma  Burkholderia mallei ATCC 23344
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1:925900..927024
Genome map
AA seq 374 aa AA seqDB search
MTALGRQLFFDPSLSGSGKLACASCHSPQHAFGPPNALPAQFGGDDLRQQGFRAVPTLKY
LQKVPAFSEHYHESDDEGDESVDAGPTGGLTWDGRVDSGAEQARVPLTSPFEMNGTPEKV
ARAVRAAPYAPAFRAAFGARVLDDDRATFEAVLQALGTFEQAPDVFYPYTSKYDAYLAGR
ARLTRAELHGLQVFNDEKKGNCASCHVSRRGLDGSPPQFSDFGLIALGVPRNRALAVNRN
PNFYDLGACGPERRDLKGRDEFCGLFRTPTLRNVALKKTFFHNGVYHSLDDVLRFYAERD
THPEKFYPVKRGVVQKFDDLPKRYWKNLNDEPPFERKRGDPPAMTDAEIRDVIAFLGTLT
DGYDPRAKPAGGAR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgctcggcaggcagttgttcttcgatccttcgctgtcgggcagcggcaagctc
gcctgcgcgtcgtgccacagcccgcagcacgcgttcgggccgccgaacgcgctgcccgcg
caattcggcggcgacgatctgcgccagcagggctttcgcgccgtgccgacgctcaaatac
ctgcagaaggtgcccgcgttcagcgagcactatcacgaatcggacgacgagggcgacgag
agcgtcgacgccggcccgacgggcgggctcacgtgggacggccgcgtggacagcggcgcc
gagcaggcgcgcgtgccgctcacgtcgccgttcgagatgaacggcacgcccgagaaggtc
gcgcgcgcggtgcgggccgcgccgtacgcgcccgcgtttcgcgcggcgttcggcgcgcgc
gtgctcgacgacgaccgcgcgacgttcgaggcggtgctgcaggcgctcggcacgttcgag
caggcgcccgacgtgttctatccgtacacgagcaagtacgacgcgtacctggcgggccgc
gcgcggttgacgcgcgccgagctgcacgggctgcaggtcttcaacgacgagaagaagggc
aactgcgcgagctgccacgtgagccggcgcgggctcgacggctcgccgccgcagttcagc
gatttcggcctgatcgcgctcggcgtgccgcgcaatcgcgcgctcgcggtgaatcggaat
ccgaatttttacgacctcggcgcatgcgggcccgagcgccgggacctgaaggggcgcgac
gagttctgcgggctgttccgcacgccgacgctgcgtaacgtcgcgctgaagaagacgttc
ttccacaacggcgtctatcactcgctcgacgacgtgctgcgcttctacgccgagcgcgac
acgcatccggaaaagttctatccggtgaagcgcggcgtcgttcagaagttcgacgacttg
ccgaagcgttactggaagaacctgaacgacgagccgccgttcgagcgcaagcgcggcgat
ccgcccgcgatgaccgatgcggagatccgggacgtgatcgcgttcctcggcacgctcacc
gacggctacgatccgcgcgcgaagccggcaggcggcgcgcgctga

DBGET integrated database retrieval system