KEGG   Burkholderia mallei ATCC 23344: BMA0995Help
Entry
BMA0995           CDS       T00204                                 

Gene name
nosZ
Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BMA0995 (nosZ)
Enzymes [BR:bma01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     BMA0995 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1:complement(1043825..1045807)
Genome map
AA seq 660 aa AA seqDB search
MSENVMANSKENTEAAAAPQDARRRRFLASSAVAGLAGASLSLGLAGCNKGGDAPAAASG
AGASAASGAAAAPAIDFGKYEVHPGKLDTYYTFSSGDHSGDIRVHGLPSGREIRRIPVYN
IDCMSGWGITNESRKIIGTKANGQLEYFTGDTHHVHMSYTDGTYDGKYIFVNDKINARIA
RVRLDTMECDAITPLPNVQGFHGIFPDKRDPLDQTINYTTRVFCGNEFHIPHPNDGRDLN
DPKKYYCLFTCVDAKTMQPRWQVKIDGNMDLVATSYDGKLACSNQYNTENGVHYEEMMAA
ERDACVFFNVARIEEAVKNGKFFKVGNSPVPVVDGTRAANADPKTALTCYVSVPKNPHGV
NASPDGKYYACSGKLSPTATLISHELMLKWFAGELKEPRDAVVAEPEIGLGPLHTGFDGK
GYAYTTLFLDSQIVKWSLEEAIKAYKGEKAAKVVVDRIDVHYQPGHGFTSMGETKEPDGQ
FFISDNKFSKDRYLPVGPLHPDSAQLIDISGEKMLLVADHPTYPEPHDSIVVRRDIIKTR
QIYNLDEFPLAVKNAKDSRVERHGRKVTVYLTSQAPTFGLREWTVKKGDEVTIILTNLDK
VEDLTHGFAIPFYNINFVVHPQQTQSVTFIADKPGVFWCFCTNFCHALHLEMRSRMLVEA
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaatgtgatggctaattcgaaggaaaacaccgaagcggcggcagcgccgcag
gacgcgcggcggcgcaggttcctcgcctcgtcggcggtcgcggggctcgcgggcgcgagc
ctgtcgctcggcctcgcgggctgcaacaagggcggcgacgcgcccgccgcggcgagcggc
gcgggcgcgagcgcggcgagcggcgcggctgcggcccccgcgatcgacttcggcaagtac
gaagtgcatccgggcaagctcgatacgtactacacgttctcgagcggcgaccattcgggc
gacatccgcgtgcacggcctgccgtccgggcgcgagatccggcgcattcccgtctacaac
atcgactgcatgtccggctggggcatcacgaacgaatcgcgcaagatcatcggcaccaag
gccaacggccagctcgaatacttcacgggcgacacgcaccacgtgcacatgtcctatacg
gacggcacgtacgacggcaagtacatcttcgtgaacgacaagatcaatgcgcgcatcgcg
cgcgtgcgcctcgacacgatggagtgcgacgcgatcacgccgctgccgaacgtgcagggc
tttcacggcatcttccccgacaagcgcgatccgctcgaccagacgatcaactacacgacg
cgcgtgttctgcggcaacgagttccacattccgcacccgaacgacggccgcgacctgaac
gacccgaagaagtactactgcctgttcacatgcgtcgacgcgaagacgatgcagccgcgc
tggcaggtgaagatcgacggcaacatggatctcgtcgcgacgtcgtatgacggcaagctc
gcgtgctcgaaccagtacaacaccgagaacggcgtgcattacgaggaaatgatggcggcc
gagcgcgacgcgtgcgtgttcttcaacgtcgcgcgcatcgaggaagcggtgaagaacggc
aagttcttcaaggtgggcaactcgcccgtgcccgtcgtcgacggcacgcgcgcggcgaac
gccgatccgaagacggccctcacctgctacgtgagcgtgccgaagaacccgcacggcgtg
aacgcgtcgcccgacggcaagtactacgcgtgctcgggcaagctctcgcccaccgcgacg
ctgatctcgcacgagctgatgctcaagtggttcgccggcgagctcaaggagccgcgcgac
gcggtggtcgcggagccggagatcggcctcgggccgctgcataccggcttcgacggcaag
ggctacgcgtacacgacgctctttctcgacagccagatcgtcaagtggagcctcgaggaa
gcgatcaaggcgtacaagggcgagaaggcggcgaaagtcgtcgtcgaccggatcgacgtg
cactaccagccgggccacggcttcacgtcgatgggcgagacgaaggagccggacggccag
ttcttcatctcggacaacaagttctcgaaggaccgctacctgcccgtcgggccgctgcat
ccggacagcgcgcagttgatcgacatcagcggcgagaagatgctgctcgtggccgaccat
ccgacgtatcccgagccgcacgactcgatcgtcgtgcgccgcgacatcatcaagacacgg
cagatctacaacctcgacgagttcccgctcgcggtgaagaacgcgaaggacagccgcgtc
gagcggcacggcaggaaggtcaccgtctacctgacgtcgcaggcgccgaccttcgggctg
cgcgaatggaccgtgaagaaaggcgacgaggtcacgatcatcctgaccaacctcgacaag
gtggaggacctgacgcacggcttcgcgatcccgttctacaacatcaacttcgtcgtgcat
ccgcagcagacgcagtcggtgacgttcatcgcggacaagcccggcgtgttctggtgcttc
tgcacgaacttctgccacgcgctgcatctggagatgcgctcgcggatgctcgtcgaggcg
tag

DBGET integrated database retrieval system