KEGG   Burkholderia mallei ATCC 23344: BMA1051Help
Entry
BMA1051           CDS       T00204                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00020  Citrate cycle (TCA cycle)
bma00310  Lysine degradation
bma01100  Metabolic pathways
bma01110  Biosynthesis of secondary metabolites
bma01120  Microbial metabolism in diverse environments
bma01130  Biosynthesis of antibiotics
bma01200  Carbon metabolism
Module
bma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMA1051 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BMA1051 (sucB)
Enzymes [BR:bma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BMA1051 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 3090924
NCBI-ProteinID: YP_102750
UniProt: A0A0H2WHD8
Position
1:complement(1095996..1097270)
Genome map
AA seq 424 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQVIATIDTEAKAGAAAAAAGAADVQSAAAPVAAPAPAAQPAAAASSTAA
TSPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPKAAPAAAPAKAAAKPALPEV
KVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKYK
DKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVV
PILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPP
QSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPARL
LLDL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagcgaccatg
ctgcagtggaagaagaagcccggcgaagccgtcgcgcaggacgaaatcctgatcgagctc
gagacggacaaggtcgtcctcgaagtgccggcgccggccgcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtcgtcgccgaccaggtgatcgcgaccatcgacaccgaa
gcgaaggcaggcgccgccgcggcagcggcaggcgccgccgacgttcagtcggccgccgct
cccgtcgccgcgccggcgcccgccgcgcagccggccgccgccgcgtcgagcaccgcggcc
acatcgcccgccgcgtcgaagctgatggccgagaagggcatcggcgccggcgacgtcgcc
ggctcgggccgcgacggccgcatcacgaagggcgacgtgctgtccgcgggcagcgcgccg
aaggccgcgccggccgccgcgccggcgaaggccgccgcgaagccggcgctgccggaagtg
aaggtgccggcatcggcgacgacgtggctcaacgaccgtccggagcagcgcgtgccgatg
tcgcgcctgcgcgcgcgcatcgccgagcgtctgctcgaatcgcagcagaccaacgcgatc
ctcacgacgttcaacgaagtgaacatgcagccggtgatggacctgcgcgcgaagtacaag
gacaagttcgagaaggagcacggcgtgaagctcggcttcatgtcgttcttcgtgaaggcg
gccgttcacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgacatc
gtctaccacggctacttcgacatcggcatcgcggtcggttcgccgcgcggcctcgtcgtg
ccgatcctgcgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgccgaa
ttcggccagaaggcaaaggacggcaagctgtcgatcgaggaaatgacgggcggcacgttc
tcgatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccgccg
cagtcggcgatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaacggccag
atcgtgatccgcccgatcaactatcttgcgctgtcgtacgaccaccggatcatcgacggt
cgcgaagcggtgctgtcgcttgtcgcgatgaaggacgcgctcgaagatccggcgcgcctg
ctgctcgacctgtaa

DBGET integrated database retrieval system