KEGG   Burkholderia mallei ATCC 23344: BMA1147Help
Entry
BMA1147           CDS       T00204                                 

Gene name
arcC
Definition
carbamate kinase (EC:2.7.2.2)
Orthology
K00926  
carbamate kinase [EC:2.7.2.2]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Purine metabolism
Arginine and proline metabolism
Nitrogen metabolism
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bma01200]
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:bma00910]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bma00230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bma00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1:1188758..1189696
Genome map
AA seq 312 aa AA seqDB search
MRIVIALGGNALLQRNQPMTEVQQRENVKIAVAQIAQIAPGNELVIAHGNGPQVGLLALQ
GAAYPAVAPYPLDVLGAQTEGMIGYLIEQEMGNLLPPDAPFATLLTQVEVDPADPAFEHP
TKPIGPVYSRDEAERLALEKGWHIAPDGDKFRRVVPSPRPRRIFEIRPVKWLLEKGTIVI
CAGGGGIPTRYDANGKLSGVEAVIDKDLCASLLARELSADLLVIATDVDGAYLDWGKPTQ
ALIEAAHPDELERLGFAAGSMGPKVQAAIEFARQTGHDAVIGSLADIVAIAEGRAGTRVS
VKVDGIRYRRPR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcgtcatcgcattgggcggcaacgcgctcttgcagcgcaatcagccgatgacc
gaagtccagcagcgcgagaacgtgaagatcgcggtcgcgcagatcgcgcagatcgcgccg
ggcaacgagctcgtgatcgcgcacggcaacgggccgcaggtcggcctgctcgcgctgcaa
ggcgcggcgtaccccgcggtcgcgccctacccgctcgacgtgctcggcgcgcagacggaa
gggatgatcggctatctgatcgaacaggaaatgggcaacctgctgccgcccgacgcgccg
ttcgcgacgctgctcacgcaagtcgaggtggatccggccgatccggcgttcgagcatccg
accaagccgatcggccccgtctactcgcgcgacgaggccgagcggctcgcgctggaaaaa
ggctggcacatcgcgcccgacggcgacaagttccgccgcgtcgtgccgagcccgcggccg
cggcgcatcttcgagatccggccggtgaagtggctgctcgagaaaggcacgatcgtgatc
tgcgcgggcggcggcggcattccgacgcgctacgacgcgaacggcaagctctcgggcgtc
gaggcggtgatcgacaaggatctgtgcgcgtcgctgctcgcgcgcgaattgagcgcggac
ctgctcgtgatcgcgaccgacgtcgacggcgcgtacctcgactggggcaagccgacgcaa
gcgctgatcgaggccgcgcatccggacgaactcgagcggctcggcttcgcggccggctcg
atggggccgaaggtgcaggcggcgatcgaattcgcgcggcagaccggccatgacgcggtg
atcggctcgctcgccgacatcgtcgcgatcgccgaggggcgcgccggcacgcgggtcagc
gtgaaggtcgacgggattcgctaccgccggccgcggtga

DBGET integrated database retrieval system