KEGG   Burkholderia mallei ATCC 23344: BMA1147Help
Entry
BMA1147           CDS       T00204                                 

Gene name
arcC
Definition
(RefSeq) carbamate kinase (EC:2.7.2.2)
  KO
K00926  
carbamate kinase [EC:2.7.2.2]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Arginine biosynthesis
Purine metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMA1147 (arcC)
  Energy metabolism
   00910 Nitrogen metabolism
    BMA1147 (arcC)
  Nucleotide metabolism
   00230 Purine metabolism
    BMA1147 (arcC)
  Amino acid metabolism
   00220 Arginine biosynthesis
    BMA1147 (arcC)
Enzymes [BR:bma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.2  carbamate kinase
     BMA1147 (arcC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1:1188758..1189696
Genome map
AA seq 312 aa AA seqDB search
MRIVIALGGNALLQRNQPMTEVQQRENVKIAVAQIAQIAPGNELVIAHGNGPQVGLLALQ
GAAYPAVAPYPLDVLGAQTEGMIGYLIEQEMGNLLPPDAPFATLLTQVEVDPADPAFEHP
TKPIGPVYSRDEAERLALEKGWHIAPDGDKFRRVVPSPRPRRIFEIRPVKWLLEKGTIVI
CAGGGGIPTRYDANGKLSGVEAVIDKDLCASLLARELSADLLVIATDVDGAYLDWGKPTQ
ALIEAAHPDELERLGFAAGSMGPKVQAAIEFARQTGHDAVIGSLADIVAIAEGRAGTRVS
VKVDGIRYRRPR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcgtcatcgcattgggcggcaacgcgctcttgcagcgcaatcagccgatgacc
gaagtccagcagcgcgagaacgtgaagatcgcggtcgcgcagatcgcgcagatcgcgccg
ggcaacgagctcgtgatcgcgcacggcaacgggccgcaggtcggcctgctcgcgctgcaa
ggcgcggcgtaccccgcggtcgcgccctacccgctcgacgtgctcggcgcgcagacggaa
gggatgatcggctatctgatcgaacaggaaatgggcaacctgctgccgcccgacgcgccg
ttcgcgacgctgctcacgcaagtcgaggtggatccggccgatccggcgttcgagcatccg
accaagccgatcggccccgtctactcgcgcgacgaggccgagcggctcgcgctggaaaaa
ggctggcacatcgcgcccgacggcgacaagttccgccgcgtcgtgccgagcccgcggccg
cggcgcatcttcgagatccggccggtgaagtggctgctcgagaaaggcacgatcgtgatc
tgcgcgggcggcggcggcattccgacgcgctacgacgcgaacggcaagctctcgggcgtc
gaggcggtgatcgacaaggatctgtgcgcgtcgctgctcgcgcgcgaattgagcgcggac
ctgctcgtgatcgcgaccgacgtcgacggcgcgtacctcgactggggcaagccgacgcaa
gcgctgatcgaggccgcgcatccggacgaactcgagcggctcggcttcgcggccggctcg
atggggccgaaggtgcaggcggcgatcgaattcgcgcggcagaccggccatgacgcggtg
atcggctcgctcgccgacatcgtcgcgatcgccgaggggcgcgccggcacgcgggtcagc
gtgaaggtcgacgggattcgctaccgccggccgcggtga

DBGET integrated database retrieval system