KEGG   Burkholderia mallei ATCC 23344: BMA1147Help
Entry
BMA1147           CDS       T00204                                 

Gene name
arcC
Definition
carbamate kinase (EC:2.7.2.2)
Orthology
K00926  
carbamate kinase [EC:2.7.2.2]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Purine metabolism
Arginine and proline metabolism
Nitrogen metabolism
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMA1147 (arcC)
  Energy metabolism
   00910 Nitrogen metabolism
    BMA1147 (arcC)
  Nucleotide metabolism
   00230 Purine metabolism
    BMA1147 (arcC)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BMA1147 (arcC)
Enzymes [BR:bma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.2  carbamate kinase
     BMA1147 (arcC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1:1188758..1189696
Genome map
AA seq 312 aa AA seqDB search
MRIVIALGGNALLQRNQPMTEVQQRENVKIAVAQIAQIAPGNELVIAHGNGPQVGLLALQ
GAAYPAVAPYPLDVLGAQTEGMIGYLIEQEMGNLLPPDAPFATLLTQVEVDPADPAFEHP
TKPIGPVYSRDEAERLALEKGWHIAPDGDKFRRVVPSPRPRRIFEIRPVKWLLEKGTIVI
CAGGGGIPTRYDANGKLSGVEAVIDKDLCASLLARELSADLLVIATDVDGAYLDWGKPTQ
ALIEAAHPDELERLGFAAGSMGPKVQAAIEFARQTGHDAVIGSLADIVAIAEGRAGTRVS
VKVDGIRYRRPR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcgtcatcgcattgggcggcaacgcgctcttgcagcgcaatcagccgatgacc
gaagtccagcagcgcgagaacgtgaagatcgcggtcgcgcagatcgcgcagatcgcgccg
ggcaacgagctcgtgatcgcgcacggcaacgggccgcaggtcggcctgctcgcgctgcaa
ggcgcggcgtaccccgcggtcgcgccctacccgctcgacgtgctcggcgcgcagacggaa
gggatgatcggctatctgatcgaacaggaaatgggcaacctgctgccgcccgacgcgccg
ttcgcgacgctgctcacgcaagtcgaggtggatccggccgatccggcgttcgagcatccg
accaagccgatcggccccgtctactcgcgcgacgaggccgagcggctcgcgctggaaaaa
ggctggcacatcgcgcccgacggcgacaagttccgccgcgtcgtgccgagcccgcggccg
cggcgcatcttcgagatccggccggtgaagtggctgctcgagaaaggcacgatcgtgatc
tgcgcgggcggcggcggcattccgacgcgctacgacgcgaacggcaagctctcgggcgtc
gaggcggtgatcgacaaggatctgtgcgcgtcgctgctcgcgcgcgaattgagcgcggac
ctgctcgtgatcgcgaccgacgtcgacggcgcgtacctcgactggggcaagccgacgcaa
gcgctgatcgaggccgcgcatccggacgaactcgagcggctcggcttcgcggccggctcg
atggggccgaaggtgcaggcggcgatcgaattcgcgcggcagaccggccatgacgcggtg
atcggctcgctcgccgacatcgtcgcgatcgccgaggggcgcgccggcacgcgggtcagc
gtgaaggtcgacgggattcgctaccgccggccgcggtga

DBGET integrated database retrieval system