KEGG   Burkholderia mallei ATCC 23344: BMA1163Help
Entry
BMA1163           CDS       T00204                                 

Gene name
cobI
Definition
precorrin-2 C(20)-methyltransferase (EC:2.1.1.130)
Orthology
K03394  
precorrin-2/cobalt-factor-2 C20-methyltransferase [EC:2.1.1.130 2.1.1.151]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMA1163 (cobI)
Enzymes [BR:bma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.130  precorrin-2 C20-methyltransferase
     BMA1163 (cobI)
    2.1.1.151  cobalt-factor II C20-methyltransferase
     BMA1163 (cobI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1206048..1206782
Genome map
AA seq 244 aa AA seqDB search
MTRKTGRLFGLGVGPGDPELLTLKALRMLQAAPVVAYFVAKGKKGNAFGIVEAHLSDAQA
HLPLVYPVTTETLPPPLCYETVIADFYDTAAALVAAHLDAGRDVAVICEGDPFFYGSYMY
LHDRLAPRYDAEVVPGVCSMLGGAAVLGVPLVYRNQSLAVLSGVLPEDELRQRLASADAA
VVMKLGRNFDKVRRMLDALGLARRALYVERATIAAQRIVPLADVDPMASPYFSLLVVPGE
KWQG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcaagaccggccgcctcttcgggctcggcgtcgggccgggcgaccccgaactg
ctgacgctcaaggcgctgcgcatgctgcaggccgcgcccgtggtggcgtacttcgtcgcg
aagggcaagaaaggcaacgcgttcggcattgtcgaggcgcatctgtccgatgcgcaggcg
cacctgccgctcgtctacccggtgacgaccgagacgctgccgccgccgctttgctacgaa
accgtgatcgccgatttctacgatacggcggccgcgctcgtcgccgcgcatctcgacgcg
ggccgcgacgtcgcggtgatctgcgaaggcgatccgttcttctacggctcgtacatgtat
ctgcatgaccggctcgcgccgcgctacgacgccgaagtcgtgccgggcgtgtgctcgatg
ctcggcggcgcggcggtgctcggcgtgccgctcgtctaccggaaccagagcctcgccgtg
ctctccggcgtgctgcccgaggacgagctgcgccagcgtctcgcgagcgccgacgcggcc
gtcgtgatgaagctcggccgcaacttcgacaaggtgcgccgcatgctcgacgcgctcggc
ctcgcgcggcgcgcgctgtacgtcgagcgcgcgacgatagccgcgcagcggatcgtgccg
ctcgcggacgtcgatccgatggcgtcgccgtatttttcgctgctcgtcgtgccgggggaa
aaatggcaaggatga

DBGET integrated database retrieval system