KEGG   Burkholderia mallei ATCC 23344: BMA1359Help
Entry
BMA1359           CDS       T00204                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bma00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BMA1359 (recR)
DNA repair and recombination proteins [BR:bma03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BMA1359 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1418182..1418784)
Genome map
AA seq 200 aa AA seqDB search
MSIKPPSALSELVEALRALPGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLRHCE
KCNTFTEAQICEVCSDPERDPALLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIG
PKEIHFDRLVRRASDGIVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGG
ELEYVDAGTIARAMLDRRTL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaagccgccgtccgcgctgtccgagctcgtcgaggcgctgcgcgcgctgccg
ggcgtcgggccgaaatccgcgcaacgcatcgcgtatcacctgatgcagcacgatcgggag
ggcgccgagcggctcggccggtcgctgctgttcgcgaccgagcacctgcggcattgcgag
aagtgcaacacgttcacggaggcgcaaatctgcgaggtgtgcagcgatccggagcgcgat
ccggcgctgctgtgcgtcgtcgagacgcccgccgatcagatcatgctcgagcagacgatg
acctatcgcgggctgtacttcgtgctgatggggcgcctgagcccgctcgacggcatcggg
ccgaaggaaatccatttcgaccggctcgtgcgccgcgcgtccgacggcatcgtgaaggag
gtcgtgctcgcgacgaacttcacgaacgagggcgaggcgaccgcgcactacctcggccag
acgctgaaggcgcgcggcctggccgtcacgcggctcgcgcgcggcgtaccggtgggcggc
gagctcgaatacgtcgatgcgggcacgatcgcgcgcgcgatgctcgaccggcgcacgctt
tag

DBGET integrated database retrieval system