KEGG   Burkholderia mallei ATCC 23344: BMA1384Help
Entry
BMA1384           CDS       T00204                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00260  Glycine, serine and threonine metabolism
bma00750  Vitamin B6 metabolism
bma01100  Metabolic pathways
bma01110  Biosynthesis of secondary metabolites
bma01120  Microbial metabolism in diverse environments
bma01230  Biosynthesis of amino acids
Module
bma_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMA1384 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BMA1384 (thrC)
Enzymes [BR:bma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BMA1384 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 3089090
NCBI-ProteinID: YP_103042
UniProt: A0A0H2WDY6
Position
1:complement(1441181..1442632)
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPSEYPRVSADELARWRALPYADLAFEI
LAKFCDDIPADDLRAITRRTYTADVYRHTRHGGNAADITPLTTLGAENGAPVSLLELSNG
PTLAFKDMAMQLLGNLFEYTLAAHGETLNILGATSGDTGSAAEYAMRGKRGVRVFMLSPH
RKMSAFQTAQMYSLQDPNIFNLAVKGVFDDCQDIVKAVSNDHAFKAQQKIGTVNSINWAR
VVAQVVYYFKGYFAATRTNDERVSFTVPSGNFGNVCAGHIARMMGLPIEKLVVATNENDV
LDEFFRTGAYRVRSAEHTYHTSSPSMDISKASNFERFVFDLLGRDPARVVQLFRDVEQKG
GFDLAASGDFARVAEFGFVSGRSTHADRLATIRDVFERYRTTIDTHTADGLKVAREHLQP
GVPMIVLETAQPIKFGETIREALGREPSRPAAFDGLEALPQRFEVVDASAQQVKDFIAAH
TGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaattacatctccacgcgcggcgccggcatcggcgagcgtcacacgttctccgacatc
ctgctcggcggcctcgcgaaggacggcgggctctacctgccgagcgagtatccgcgggtg
agcgcggacgagctcgcgcgctggcgcgcgctgccgtacgcggatctcgcgttcgagatc
ctcgcgaagttctgcgacgacatcccggccgacgacctgcgcgcgatcacgcgccgcacg
tatacggccgacgtctatcgtcacacgcgccacggcggcaacgcggccgacatcacgccg
ctcacgacgctcggtgccgagaacggcgcgccggtctcgctgctcgaactgtcgaacggc
ccgacgctcgcgttcaaggacatggcgatgcagttgctcggcaacctgttcgagtacacg
ctcgccgcgcacggcgaaacgctgaacatcctcggcgcgacgtcgggcgatacgggcagc
gcggccgaatacgcgatgcgcggcaagcggggcgtgcgcgtgttcatgctgtcgccgcac
cggaagatgagtgcgttccagacggcccagatgtacagcctgcaggacccgaacatcttc
aacctcgcggtgaagggcgtgttcgacgattgccaggacatcgtgaaggccgtgtcgaac
gatcacgcgttcaaggcgcagcagaagatcggcacggtcaattcgatcaactgggcgcgt
gtcgtcgcgcaggtcgtgtactacttcaagggctatttcgcggcgacgcgcacgaacgac
gagcgcgtgtcgtttacggtgccgtcgggcaacttcggcaatgtctgcgcgggccacatc
gcgcggatgatggggctgccgatcgagaagctcgtcgtcgcgaccaacgagaacgacgtg
ctcgacgaattcttccgcacgggtgcgtatcgcgtgcgcagcgccgagcacacgtaccac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgagcgcttcgtgttcgac
ctgctcggccgcgatccggcgcgcgtcgttcagctgtttcgcgacgtcgagcaaaagggt
ggcttcgatctcgcggcgagcggcgatttcgcgcgcgtcgccgagttcggcttcgtgtcg
ggccgcagcacgcacgcggaccggctcgcgacgatccgcgacgtgttcgagcgctatcgc
acgacgatcgacacgcacacggccgacggcctgaaagtggcgcgcgagcatctgcagccg
ggcgtgccgatgatcgtgctcgagaccgcgcagccgatcaagttcggcgaaacgattcgc
gaggcgctcgggcgggagccgtcgcggcccgccgcgttcgacgggctcgaggcgttgccg
cagcgcttcgaggtggtcgacgcgagcgcgcagcaggtgaaggacttcatcgccgcgcac
acgggcgcatga

DBGET integrated database retrieval system