KEGG   Burkholderia mallei ATCC 23344: BMA1549Help
Entry
BMA1549           CDS       T00204                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00900  Terpenoid backbone biosynthesis
bma01100  Metabolic pathways
bma01110  Biosynthesis of secondary metabolites
bma01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMA1549 (dxr)
Enzymes [BR:bma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BMA1549 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh NmrA T2SSE
Motif
Other DBs
NCBI-GeneID: 3088281
NCBI-ProteinID: YP_103189
UniProt: Q62JD0
Position
1:complement(1607184..1608380)
Genome map
AA seq 398 aa AA seqDB search
MQKRLTLLGSTGSIGDSTLDVVARHPERFAVHALTAHRNGEKLVAQCLRFAPDVAVVGDA
ETAARVEAQLRAAGSRTQVAYGKQALVDVSKSDGCDTVVAAIVGAAGLAPSLAAARAGKR
ILLANKEALVMSGAIFMDAVRDHGAILLPVDSEHNAIFQCMPRDAAEHGGIAKIIVTASG
GPFRTREPATLASVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWLFGLPSEHID
VLIHPQSVIHSLVSYRDGSVLAQLGNPDMRTPIAHALAFPERVDAGVAQLDLAQIATLTF
EKPDYARFPCLALAIDALEAGGVASAALNAANEIAVDAFLSRRIRFTAIAQTVGAVLDGL
SNRTPGGLDDVIEADAAARRAATAFIGKLPAPGVERAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacgtctgacattgctcggttcgacgggctcgatcggagacagcacgctcgac
gtcgtcgcgcgtcatccggaacgcttcgcggttcatgcgctcacggcccaccgcaacggc
gagaagctcgtcgcccagtgcctgcgctttgcgccggacgtcgcggtggtcggcgacgcc
gaaaccgccgcgcgggtcgaggcgcaattgcgcgccgcgggcagccggacccaggtcgcg
tacggcaagcaggcgctcgtcgacgtatcgaagagcgacggctgcgacaccgtcgtcgcg
gcgatcgtcggcgcggcggggctcgcgccgagcctcgccgccgcgcgcgcgggcaagcgc
atcctgctcgcgaacaaggaagcgctcgtgatgtcgggcgcgatcttcatggacgcggtg
cgcgatcacggcgcgatcctgttgcccgtcgacagcgagcacaacgcgatcttccagtgc
atgccgcgcgacgcggccgagcatgggggcatcgcgaagatcatcgtgaccgcgtcgggc
ggcccgttccgcacgcgcgagcccgcgacgctcgcgagcgtgacgcccgacgaggcgtgc
aagcatccgaactgggtgatgggccgcaagatctccgtcgattccgcgacgatgatgaac
aagggcctcgaggtgatcgaggcgcactggctgttcggcctgccgagcgagcacatcgac
gtgctgatccatccgcagagcgtgatccattcgctcgtgtcgtatcgcgacggctcggtg
ctcgcgcagctcggcaacccggacatgcgcacgccgatcgcgcacgcgctcgcgtttccc
gagcgtgtcgacgcgggcgtcgcgcagctcgatctcgcgcagatcgcgacgctcacgttc
gagaagcccgactacgcgcgcttcccgtgcctcgcgctcgccatcgacgcgctcgaggcg
ggcggcgtcgcgagcgcggcgctcaatgcggcgaacgaaatcgccgtggacgcgttcctg
tcgcgccgcattcgcttcaccgcgatcgcgcagacggtcggcgcggtgctcgatgggctg
tccaaccgcacgccgggcggcctcgacgacgtgatcgaagccgacgccgccgcgcgccgc
gcggcgacggcgttcatcggcaagctgcccgcgcccggcgtcgagcgcgccgcctga

DBGET integrated database retrieval system