KEGG   Burkholderia mallei ATCC 23344: BMA1568Help
Entry
BMA1568           CDS       T00204                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMA1568 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BMA1568 (dapE)
Enzymes [BR:bma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BMA1568 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1631141..1632280
Genome map
AA seq 379 aa AA seqDB search
MSATLALTEQLIARASVTPDDQHCQQLMIERLAALGFECETIASHGVTNFWAVKRGTAGR
AGKLLAFAGHTDVVPTGPLEQWRSPPFVPTHRDGKLYGRGAADMKTSLAGFVVAAEEFVA
AHPQHRGSIGFLITSDEEGPATDGTVKVVEALAARGERLDYCIVGEPTSTATLGDVVKNG
RRGSMSGELVVKGVQGHIAYPHLAKNPIHLLAPALAELAAEQWDEGNEYFPPTTWQVSNL
RAGTGATNVIPGHADLLFNFRFSTASTVEGLQARVHAILDRHGLDYTLNWSVSGLPFLTP
RGELSNALDAAIRAETGVSPELSTTGGTSDGRFIARICPQVIEFGPPNASIHKIDEHIDV
RFVDPLKNVYRRVLEQLIA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccacccttgccctcaccgaacagttgatcgcgcgcgcgtccgtcacgcccgac
gatcagcactgccagcaattgatgatcgagcgcctcgccgccctcggcttcgagtgcgaa
acgatcgcgtcgcacggcgtgacgaacttctgggccgtcaagcgcggcacggccggccgc
gcaggcaagctgctcgcgttcgcgggccataccgacgtcgtgccgaccggcccgctcgag
cagtggcgctcgccgccgttcgtgccgacgcaccgcgacggcaagctgtacggccgcggc
gcggccgacatgaaaacctcgctcgcgggcttcgtcgtcgcggccgaggagttcgtcgcc
gcgcatccgcagcaccgcggctcgatcggtttcctgatcacgagcgacgaggaaggcccg
gccaccgacggcaccgtgaaagtcgtcgaggcgctcgccgcgcgcggcgagcgcctcgat
tactgcatcgtcggcgaaccgacctcgacggcgacgctcggcgacgtcgtgaagaacggc
cggcgcggctcgatgtcgggcgagctcgtcgtcaagggcgtgcaaggccatatcgcgtat
ccgcatctcgcgaagaacccgatccatctgctcgcgccggcgctcgccgagctcgccgcc
gagcaatgggacgaaggcaacgagtactttccgccgaccacctggcaggtgtcgaacctg
cgcgcgggcaccggcgcgacgaacgtgattccgggccacgccgatctgctgttcaacttc
cgcttctcgacggcgagcacggtcgagggcctgcaggcgcgcgtgcacgcgatcctcgac
aggcacgggctcgattacacgctgaactggtcggtgagcggcctgccgttcctcacgccg
cgcggcgagctgtcgaacgcgctcgacgccgcgatccgcgcggaaacgggcgtctcgccc
gagctgtcgacgacgggcggcacgtccgacggccgcttcatcgcgcgcatctgcccgcag
gtgatcgagttcggcccgccgaacgcgagcatccacaagatcgacgagcacatcgacgtg
cgcttcgtcgacccgctgaagaacgtgtaccgccgcgtgctcgaacaactgatcgcctga

DBGET integrated database retrieval system