KEGG   Burkholderia mallei ATCC 23344: BMA1586Help
Entry
BMA1586           CDS       T00204                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bma01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bma00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1:1651302..1652609
Genome map
AA seq 435 aa AA seqDB search
MSRQQQAQELQKQWETDPRWKGIKRAFTAEDVVRLRGSIQQEHTLAKRGAEKLWTLINNE
PFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKR
INNTLTRADQIQWSEGKNPGDEGYVDFFAPIVADAEAGFGGVLNAFELMKAMIEAGASGV
HFEDQLASVKKCGHMGGKVLVPTREAVAKLTAARLAADVMGTPTVLVARTDAEAADLITS
DIDDNDKPYLTGERTVEGFFRTKPGLEQAISRGLAYAPYADLIWCETGKPDLEYAKKFAE
AIHKQFPGKLLSYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMF
NLAHGYARTQMSAFVELQQAEFAAADKGFTAVKHQREVGTGYFDAVTQTVEREASTTALH
GSTEDEQFFDGQKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtcaacaacaggctcaggaactgcaaaagcaatgggaaaccgatccgcgctgg
aagggcatcaagcgcgcgttcaccgctgaggacgtcgtgcgcctgcgcggctcgatccag
caagagcacacgctcgcgaagcgcggcgcggaaaagctctggacgctcatcaacaacgag
ccgttcgtcaacgcactcggcgcgctgacgggcaaccaggcgatgcagcaggtcaaggcc
ggcctcaaggcgatctatctgtcgggctggcaagtcgcgggcgacgcgaacgtcgcgggc
gaaatgtatccggaccagtcgctgtacccggcgaactcggtgccgctcgtcgtcaagcgc
atcaacaacacgctcacgcgcgccgatcagatccagtggtcggaaggcaagaaccccggc
gacgaaggctatgtcgacttcttcgcgccgatcgtcgccgacgcggaagccggcttcggc
ggcgtgctgaacgcgttcgaactgatgaaggcgatgatcgaggcgggcgcgtcgggcgtt
cacttcgaagaccagctcgcctcggtcaagaagtgcggccacatgggcggcaaggtgctc
gtgccgacccgcgaggcggtcgcgaagctgacggccgcgcgtctcgccgccgacgtgatg
ggcacgccgaccgtgctggtcgcgcgcaccgacgccgaagcggccgacctgatcacgtcc
gacatcgacgacaacgacaagccgtacctgacgggcgagcgcacggtcgaaggcttcttc
cgcacgaagccgggcctcgagcaggcgatctcgcgcggcctcgcctatgcgccgtacgcc
gacctgatctggtgcgaaaccggcaagccggatctcgaatacgcgaagaagttcgcggaa
gcgatccacaagcagttcccgggcaagctgctgtcgtacaactgctcgccgtcgttcaac
tggaagaagaacctcgacgacgcgacgatcgcgaagttccagaaggaactcggcgcgatg
ggctacaagttccagttcatcacgctcgccggcttccatgcgctgaactactcgatgttc
aacctcgcgcacggctacgcccgcacgcagatgagcgcgttcgtcgaactgcagcaagcc
gagttcgcggcggccgacaagggcttcaccgcggtcaagcaccagcgtgaagtcggcacc
ggctacttcgacgcggtgacgcagacggtcgagcgcgaagcgtcgacgaccgcgctgcac
ggctcgaccgaagacgaacagttcttcgacggccagaaagtcgcctga

DBGET integrated database retrieval system