KEGG   Burkholderia mallei ATCC 23344: BMA1768Help
Entry
BMA1768           CDS       T00204                                 

Gene name
recD
Definition
(RefSeq) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bma00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BMA1768 (recD)
Enzymes [BR:bma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BMA1768 (recD)
DNA repair and recombination proteins [BR:bma03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BMA1768 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Helicase_RecD Viral_helicase1 UvrD-helicase DUF2075 MukB UvrD_C AAA_29 CbiA
Motif
Other DBs
NCBI-GeneID: 3089045
NCBI-ProteinID: YP_103383
UniProt: A0A0H2WFF3
Position
1:complement(1855465..1858161)
Genome map
AA seq 898 aa AA seqDB search
MSVVDERFAWTGGLADRLPEPADFGLALAEGFARRIGMLSRRVGASAAAARWAARAAFAA
SRATAAGHVCVALRALAQRDDEPYDDVRAALAASGVTAFDGIVRGGECPLVVDRDGRLYL
ARYFEYETRLANALVERSRCGGAPAGGADALSPDALGERLVRYFGPQKERGVDWQRVAAL
IALTGRVTIVSGGPGTGKTTTVVGVIACLLDAHPDLRIALAAPTGKAAQRMQEALHARAG
SLPAELAARLPRTSCTLHRLLGGGPGGRFAHHRDNPLPYDLVVVDEASMIDVALAAHLLD
ALAPNARLVLLGDKDQLAAVEAGAVFAELSARPAFSPATCATIARTLGVGEAEFVAALPD
GFVVQAGGAERVADARAAAADMDAAARGTAGAAAAAARTTAAAAARMTTAAAAATGAAPE
SAAQRAPAPHAGRRGGGRASNRTVDDAQGSLFAFDDDAFGGGTSGGEPGAGAQGAGRRDG
GAPSLDGPHAGHRDGGASPGVAHSRRDAFDARARSGSADVSDLENAARAYAPAGAAGPAD
SPADASFVEPAAWIEADELAWLDNAVFSFSEGASANAEADGRRSAAATATDAGARTAPPV
AREATAPTPRETARSDGSAVAPLTDCVVWLERNYRFGLDSPIGRLSLAIRRGAVQDALDA
LSTQDDAAARFSDDGGATLSAATVEQLARGFAGYAAALRDALATPEPDALPLFDVLNRFR
VLCATRTGARGAEEVNARMAAEVRRAVRVPLALGAHWFAGRPVMVTRNDYALGLFNGDIG
IALPGARGALRVWFRGADGRARAVSPAALPPHDTAFALTVHKSQGSEFDDAALILPASFN
RVLSRELVYTAITRARARVQVIGSRAVLALAIATRTARDSGLAARIADALRARQEGAR
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggtcgacgaacgtttcgcgtggacgggcggcctggcggaccgtctgcccgag
ccggccgatttcgggctcgcgctcgccgaaggcttcgcgcgccggatcgggatgctgtcg
cggcgtgtcggcgcgagcgccgcggccgcgcgctgggcggcacgcgcggcgttcgccgcg
agccgcgcgacggcggcggggcacgtatgcgtcgcgctgcgcgcgctcgcgcagcgcgac
gacgagccgtacgacgacgtacgcgcggcgctcgccgcgagcggcgtgaccgcgttcgac
ggcatcgtgcgcggcggcgagtgcccactcgtcgtcgatcgcgatggtcggctgtatctc
gcgcgctacttcgaatacgagacgcggctcgcgaacgcgctcgtcgagcggagccgatgc
ggcggcgcgccggcgggcggcgccgatgcgctctcgcccgacgcgctcggcgagcggctc
gtccgctatttcgggccgcagaaggagcggggcgtcgattggcagcgcgttgcggccctc
atcgcgctcacgggccgcgtgacgatcgtgagcggcgggccgggcaccggcaagacgacg
acggtcgtcggcgtgatcgcgtgcctgctcgatgcgcatccggacttgcggatcgcgctt
gccgcgcccaccggcaaggccgcgcagcggatgcaggaggcgctgcacgcgcgcgccggc
agcctgccggcggaactcgcggcgcgcctgccgcgcacgtcctgcacgctgcaccggctg
ctgggcggtggcccgggcgggcgcttcgcgcaccaccgcgacaatccgctgccgtacgat
ctcgtcgtcgtcgacgaggcttcgatgatcgacgtcgcgctcgccgcgcatttgctcgac
gcgctcgcgccgaacgcgcgcctcgtgctgctcggcgacaaggatcagctcgcggccgtc
gaggcgggcgcggtgttcgccgagctgagcgcgcgtcccgcgttcagcccggcgacgtgc
gcgacgatcgcgcgcacgctcggcgtcggcgaggccgagttcgtggcggcgctgccggac
gggttcgtcgtgcaggcgggcggcgcggagcgcgtggcggacgcgcgtgcggcagcggcc
gatatggacgcggccgcgcgcgggacggccggcgccgcagctgcggccgcacgaacgacc
gcggccgcagccgcacgaatgaccacggccgcagccgcggcgacgggggccgcgccggaa
tccgccgcgcaacgcgcgccggcgccgcacgcgggccggcgcggcggcgggcgcgcatcg
aatcggaccgtcgacgatgcgcagggatcgttgttcgcgttcgacgacgacgcattcggt
gggggcacgtcgggcggcgagccgggggccggcgcgcaaggtgccgggaggcgagatggc
ggggcgccgagcctcgacgggccgcacgccgggcatcgggacggcggcgcatcgcccggc
gtcgcgcacagccggcgcgatgcgttcgacgcgcgtgcccggtcgggttcggcggatgtt
tccgacctggaaaacgccgcgcgcgcgtacgcgccggcgggcgcagccggcccggccgat
tcgccggcggacgcgtctttcgtcgagccggccgcgtggatcgaagcggacgaactcgcg
tggctcgacaacgcggtcttttcgttctccgaaggcgcttcggcgaatgccgaagccgac
gggcggcgaagcgccgcggcgacggcgaccgacgcgggcgcgcgcaccgcgccgccggtt
gcgcgggaagcgacggcgccgacgccgcgcgagaccgcgcgatcggacggttccgccgtc
gcgccgctgaccgactgcgtcgtctggcttgaacgcaactatcgcttcggccttgattcg
ccgatcggccggctgtcgcttgcgattcgccgcggcgcggtgcaggacgcgctcgacgcg
ctatcgacgcaagacgacgcggccgcgcgttttagcgacgacggcggtgcgacgctgtcg
gccgcgacggtcgagcagctcgcgcgaggcttcgccggctatgcggccgcgctgcgcgac
gcgctggcgacgcccgaacccgatgcgctgccgctcttcgacgtgctcaaccgctttcgc
gtgctttgcgcgacgcgcacgggcgcgcgcggcgcggaggaagtcaacgcgcgcatggcg
gccgaggtgcgccgcgcggtgcgcgtgccgctcgcgctcggtgcgcactggttcgccgga
cggcccgtgatggtgacgcgcaacgattacgcgctcggcctcttcaacggcgacatcggc
attgcgctgcccggcgcgcgcggtgcgctgcgcgtctggtttcgcggcgcggacggccgc
gcccgggcggtgtcgcccgccgcgctgccgccgcacgacacggcgttcgcgctgaccgtc
cacaaatcgcagggctcggaattcgacgacgcggcactgatcctgcccgcgtcgttcaat
cgcgtgctgtcgcgcgaactcgtctacaccgcgatcacgcgcgcgcgcgcgcgcgtgcag
gtgatcggctcgcgcgcggtgctcgcgctcgcgatcgcgacgcgcacggcgcgcgattcc
ggccttgccgcacgaatcgccgatgcgctgcgcgcgcggcaggagggcgcgcgatga

DBGET integrated database retrieval system