KEGG   Burkholderia mallei ATCC 23344: BMA1994Help
Entry
BMA1994           CDS       T00204                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BMA1994 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMA1994 (pyrB)
Enzymes [BR:bma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BMA1994 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1:complement(2092718..2093749)
Genome map
AA seq 343 aa AA seqDB search
MTTDTSGRTGNPAAAAPAERFRYGFLKGNPQLTKNGELKHLLTIEGLPRAILNQILDTAE
QFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAAKRLSADVINLNINASSTSKG
ESLLDTINNLSAMHADLFVVRHASSGAPYLIAEHCAPHVHVINAGDGRHAHPTQGLLDMY
TIRHYKRDFTKLRVAIVGDILHSRVARSDIHALTTLGVPEVRAIGPRTLLPGGLEQMGVR
VFHNLDEGLRDVDVIIMLRLQNERMSGALLPSAQEYFKSWGLTPERLALAAPDAIVMHPG
PMNRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGTSD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgacacctccggccgcaccggcaatcccgccgcggccgcgcccgccgagcgc
tttcgctatggctttctgaagggcaacccgcagctcacgaagaacggcgagctcaagcat
ctgttgacgatcgagggcctgccgcgcgcgatcctcaatcagattctcgacaccgccgag
cagttcgtcagcgtgaccgaccgcgaagtgaagaaggtgccgctcttgcgcggcaaatcg
gtattcaacctgttcttcgagaattcgacgcgcacgcgcacgacgttcgagatcgccgcg
aagcggctgtccgccgacgtgatcaacctgaacatcaacgcgtcgtcgacgagcaagggc
gagtcgctcctcgacacgatcaacaatctgtcggcgatgcacgccgatctcttcgtcgtg
cgccacgcatcgagcggcgcgccgtacctgatcgccgagcactgcgcgccgcacgtgcac
gtgatcaacgcgggcgacggccgtcacgcgcacccgacgcagggccttctcgacatgtac
acgatccgccactacaagcgcgacttcacgaagctgcgcgtcgcgatcgtcggcgacatt
ctccattcgcgcgtcgcgcgctcggacattcacgcgctgacgacgctcggcgtgcccgag
gtgcgcgcgatcggcccgcgcacgctgctgccgggcgggctcgagcagatgggcgtgcgc
gtgttccacaatctcgacgaaggcctgagggacgtcgacgtgatcatcatgctgcgcctg
cagaacgagcggatgagcggcgcgctgctgccgtccgcgcaggaatatttcaagagctgg
ggcttgacgcccgagcgccttgcgctcgccgcgcccgacgcgatcgtgatgcacccgggg
ccgatgaaccgcggcgtcgagatcgattcgcaagtggccgacggcccgcaatcggtgatc
ctgaaccaggtgacgttcggcatcgcggtgcgcatggccgtgatgggcatcgtcgcgggc
acgagcgactga

DBGET integrated database retrieval system