KEGG   Burkholderia mallei ATCC 23344: BMA2132Help
Entry
BMA2132           CDS       T00204                                 

Definition
(RefSeq) bifunctional glucokinase/RpiR family transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00010  Glycolysis / Gluconeogenesis
bma00052  Galactose metabolism
bma00500  Starch and sucrose metabolism
bma00520  Amino sugar and nucleotide sugar metabolism
bma00521  Streptomycin biosynthesis
bma01100  Metabolic pathways
bma01110  Biosynthesis of secondary metabolites
bma01120  Microbial metabolism in diverse environments
bma01130  Biosynthesis of antibiotics
bma01200  Carbon metabolism
Module
bma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA2132
   00052 Galactose metabolism
    BMA2132
   00500 Starch and sucrose metabolism
    BMA2132
   00520 Amino sugar and nucleotide sugar metabolism
    BMA2132
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMA2132
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BMA2132
Enzymes [BR:bma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BMA2132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6 SIS SIS_2 ROK
Motif
Other DBs
NCBI-GeneID: 3091251
NCBI-ProteinID: YP_103702
UniProt: Q62HW8
Position
1:2221265..2223190
Genome map
AA seq 641 aa AA seqDB search
MSTGAQTKAAAASQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGAEYPTLTDAIR
KYLKDAKIGRVNHAAIAIANPVDGDQVRMTNHNWSFSIEATRRALGFDTLLVVNDFTALA
MALPGLTDAQRVQIGGGTRRQNSVIGLMGPGTGLGVSGLIPADDRWIALGSEGGHATFAP
MDEREDLVLQYARRKYPHVSFERVCAGPGMEIIYRALAARDKKRIAANVDTADIVERAHA
GDALALEAVECFCAILGTFAGNLAVTLGALGGIYIGGGVVPKLGELFMRSPFRARFEAKG
RFEAYLANIPTYLITAEYPAFLGVSAILAEQLSNRTGGASSAVFERIRQMRDALTPAERR
VADLALNHPRSIINDPIVNIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM
SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSN
IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQ
AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLVMIDILAVGVAIRRAA
PNAELAEAMARAKARAGASAGDEAADVLDWLSHGAAPAAKD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaactaaggccgccgcggcgagccagcacgcggacgggccgcgc
ctattggccgacgtcggcggcacgaacgcgcgcttcgcgctcgagacgggcccgggagaa
atcacgcagatccgcgtgtacccgggcgccgagtatccgacgctcaccgacgcgatccgc
aagtatctgaaggacgcgaagatcggccgcgtgaatcacgcggcgatcgcgatcgcgaac
cccgtcgacggcgatcaggtccggatgacgaatcacaactggagcttctcgatcgaggcg
acgcgccgcgcgctcggcttcgatacgctgctcgtcgtcaacgatttcaccgcgctcgcg
atggcgctgcccggcctgaccgatgcgcagcgcgtacagatcggcggcggcacgcgccga
cagaacagcgtgatcggcctgatggggccgggcacggggctcggcgtgtcggggctcatt
cccgccgacgaccgctggatcgcgctcggcagcgaaggcggccacgcgacgttcgcgccg
atggacgagcgcgaggatctcgtgctgcaatacgcgcgccgcaagtatcctcacgtgtcg
ttcgagcgcgtatgcgcgggcccgggcatggagatcatctatcgcgcgctcgccgcgcgc
gacaagaagcgtatcgccgcgaacgtcgacacggccgacatcgtcgagcgcgcgcacgcg
ggcgatgcgctcgcgctcgaggcggtcgagtgcttctgcgcgattctcggcacgttcgcc
ggcaacctcgcggtcacgctcggcgcgttgggcggcatctatatcggcggcggcgtcgtg
ccgaagctcggcgagctgttcatgcgctcgccgtttcgcgcgcgcttcgaggcgaagggc
cgcttcgaggcgtatctcgcgaacatcccgacctacctgatcaccgcggaatacccggcg
tttctcggcgtatcggcgatcctcgccgagcaactgtcgaaccgcacgggcggcgcgtcg
tcggccgtgttcgagcgcatccgccagatgcgcgacgcgttgacgcccgccgagcggcgc
gtcgccgatctcgcgctcaaccatccgcgctcgatcatcaacgatccgatcgtcaacatc
gcgcgcaaggccgacgtgagccagcccaccgtgatccgcttctgccgctcgctcggctgc
caggggctgtcggacttcaagctgaagctcgcgacgggcctcaccggcacgatcccgatg
agccacagccaggtgcatctgggcgacaccgcgaccgatttcggcgcgaaggtgctcgac
aacacggtatcggcgatccttcagttgcgcgagcatctgaacttcgagcacgtcgagcag
gcgatcgacatcctgaacaatgcgcggcgcatcgagttctacggcctgggcaattcgaac
atcgtcgcgcaggacgcgcactacaagttcttccgcttcgggattccgacgatcgcgtac
ggcgacctgtacatgcaggcggcgtcggccgcgctcctcggcaagggcgacgtgatcgtc
gcggtgtcgaagtcggggcgcgcgccggagctgttgcgcgtgctcgacgtcgcgatgcag
gcgggcgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgccaagcgcgcgacg
gtcgcgctcgagaccgatcacatcgagatgcgcgagtcgcagttgtcgatgatctcgcgg
atcctgcatctcgtgatgatcgacatcctcgcggtcggcgtcgcgatccgccgcgccgcg
ccgaacgcggagctcgcggaggcgatggcgcgcgcgaaggcgcgcgcgggcgcgagcgcg
ggcgacgaggccgccgacgtgctcgactggctgagccacggcgcggcgcccgcggcgaag
gactga

DBGET integrated database retrieval system