KEGG   Burkholderia mallei ATCC 23344: BMA2137Help
Entry
BMA2137           CDS       T00204                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bma00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1:2226043..2227062
Genome map
AA seq 339 aa AA seqDB search
MNTTTLSTKLNAFARLNLIDAPTPLQYLPRLSAHVGRDIHVKRDDCTPLAMGGNKLRKLE
FLAADALGQNADVLVTAGAIQSNHVRQTAALVAQLGLGCVALLENPIAAARDDYLQSGNR
LLLDLFDVRAHVVDGLDDVDRQLEAAARRLRDEGRRPYVIPIGGSNPLGALGYVRAGLEL
AQQIRAAERDFAAVVLASGSAGTHAGLAFALAHALPGLPVIGVTVSRTDAQQRPKVRHLL
DGMSGLLDVALPAGARIDLWDDYFAPRYGEPNRAGIDALRLLARTEGLLLDPVYTGKAMA
GLIDGVARGRFDGNGPVLFVHTGGAPALFAYQDTCRASR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgacgacgctctcgacgaaactgaacgccttcgcccgcctgaacctgatcgac
gcgccgacgccgctgcagtacttgccgcgcctgtccgcgcacgtcggccgcgacatccac
gtgaagcgcgacgactgcacgccgctcgcgatgggcggcaacaagctgcgcaagctcgaa
ttcctcgccgcggacgcgctcggccaaaacgcggacgtgctggtgaccgcgggcgcgatc
cagtcgaatcacgtccggcagacggccgcgctcgtcgcgcagctcggcctcggctgtgtc
gcgctgctcgaaaacccgatcgcagccgcgcgcgacgattatctgcaaagcggcaaccgg
ctgctgctcgatctgttcgacgtgcgcgcgcacgtcgtcgacgggctcgacgacgtcgac
cggcaactcgaagccgccgcgcggcggctgcgcgacgaagggcggcgcccgtacgtgatc
ccgatcggcggatcgaatccgctcggcgcgctcggctacgtgcgcgcgggcctcgagctc
gcgcagcagatccgcgcggccgagcgcgatttcgcggctgtcgtgctcgcgtccggcagc
gccggcacgcacgcgggcctcgcgttcgcgctcgcgcacgcgttgcccgggctgccggtg
atcggcgtgacggtatcgcgcaccgacgcgcagcagcgcccgaaggtgcggcatctgctc
gacggcatgagcgggctgctcgacgtcgcgttgccggcgggcgcgcgcatcgatctgtgg
gacgactacttcgcgccgcgctacggcgagcccaatcgcgcgggcatcgacgcgctgcgg
ctgctcgcgcgaaccgaggggctgctgctcgatccggtgtacacgggcaaggcgatggcg
ggtctcatcgacggcgtcgcgcgcggccgcttcgacggaaacggcccggtgctgttcgtg
catacgggcggcgcgcccgcgctgttcgcgtatcaggacacgtgccgcgcgagccgatga

DBGET integrated database retrieval system