KEGG   Burkholderia mallei ATCC 23344: BMA2321Help
Entry
BMA2321           CDS       T00204                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bma00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1:2416465..2416992
Genome map
AA seq 175 aa AA seqDB search
MTVAYLGLGANLGDARQALKDAVVCLAQQHAITVLGKSSLYRTAPVDASGGDYYNCVVKI
DTVLAARALLALCQKIEHHFGRERPYRNAPRTLDIDILLYGELTIDEPDLVVPHPRLTER
AFALVPLVEIEPALAIPARGRADGFLADVAHQRIEKVQTCQCLAMRAAAEKNRCR
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgcttatctcgggttgggggccaatctcggcgacgcgcgccaggccttgaag
gacgcagtggtctgcctcgcccagcagcacgccatcacggtgctcggcaagtcgagcctg
tatcgcaccgcgcccgtcgacgcgagtggcggcgattactacaactgcgtcgtgaagatc
gacacggtgctcgccgcgcgcgcgctcctcgcgctgtgccagaagatcgagcaccacttc
ggccgcgagcggccgtaccgaaacgcgccgcgcacgctcgacatcgacatcctgctctac
ggtgaactgacgatagacgaacccgacctcgtcgttccgcatccgcgcctgaccgagcgc
gcgttcgcgctcgtgccgctcgtcgagatcgagccggcgctcgcgattcccgcacgcggc
cgcgccgacggattcctcgccgacgtcgcgcaccagcgcatcgagaaggtccagacctgc
cagtgcctcgcgatgcgggccgccgccgaaaagaaccgttgccgatga

DBGET integrated database retrieval system