KEGG   Burkholderia mallei ATCC 23344: BMA2476Help
Entry
BMA2476           CDS       T00204                                 

Definition
ribonuclease SA (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bma  Burkholderia mallei ATCC 23344
Brite
Enzymes [BR:bma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     BMA2476
Messenger RNA biogenesis [BR:bma03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     BMA2476
Transfer RNA biogenesis [BR:bma03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    BMA2476
 Prokaryotic Type
    BMA2476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2577231..2577662)
Genome map
AA seq 143 aa AA seqDB search
MARKWLRNGALASVFAIVAMGNIGATPGSLVSAAYAREAATVDGAAAQVDTIPASRLPRE
AATTLSLIAAGGPYPYGKDGAVFGNYERILPKMRRGYYHEYTVPTPRARNRGARRIVCGG
PLRRVDNCYYTGDHYNSFKRIVD
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctcgcgtccgtcttcgcgatcgtcgcgatg
ggcaacatcggcgctacgccgggcagtctggtttccgccgcatacgcacgggaagccgcc
acggtcgacggggcggcggcgcaggtcgatacgatccccgcatcccgtttgccgcgcgag
gcagcaaccacgctcagcctgatcgccgcgggcggtccctatccgtacgggaaagacggc
gcggtattcggcaattacgaacggatcttgccgaagatgcggcgcggctattaccacgag
tacacggtgccgacgccgcgcgcccgcaatcgcggcgcgcggcgcatcgtctgcggcggc
cccttgaggcgcgtcgacaattgttattacaccggcgaccactacaacagtttcaaacgt
atcgttgattga

DBGET integrated database retrieval system