KEGG   Burkholderia mallei ATCC 23344: BMA2520Help
Entry
BMA2520           CDS       T00204                                 

Gene name
proB
Definition
(RefSeq) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00330  Arginine and proline metabolism
bma00332  Carbapenem biosynthesis
bma01100  Metabolic pathways
bma01130  Biosynthesis of antibiotics
bma01230  Biosynthesis of amino acids
Module
bma_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BMA2520 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BMA2520 (proB)
Enzymes [BR:bma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BMA2520 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 3089375
NCBI-ProteinID: YP_104066
UniProt: Q62GV5
Position
1:complement(2624701..2625819)
Genome map
AA seq 372 aa AA seqDB search
MRSIIADSKRLVVKVGSSLVTNDGRGLDHDAIGRWAAQIAALRGAGKEVVLVSSGAIAEG
MQRLGWSKRPREIDELQAAAAVGQMGLAQVYESRFAEHGIRTAQILLTHADLADRERYLN
ARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEGDTLVILTDQPGLFT
ADPRKDPGATLVAEASAGAPELEAMAGGAGSSIGRGGMLTKILAAKRAAHSGANTVIASG
RERDVLVRLAAGEAIGTQLIARTARMAARKQWMADHLQVRGHVVIDAGAVDKLTAGGKSL
LPIGVVAVQGVFARGEVIACVDDTGREVARGITNYSSAETKLIQRKPSGEIETVLGYMLE
PELIHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgatcatcgccgattcgaagcgcctggtagtgaaagtgggctcgagcctcgtc
accaacgacggccgcgggctcgatcatgacgccatcggccgatgggccgctcagatcgcc
gcgctgcgcggcgcgggcaaggaagtggtgctcgtcagctcgggcgcgatcgcggaaggc
atgcagcgcctcggttggagcaagcggccgcgcgagatcgacgagttgcaagcggccgcg
gccgtcgggcaaatggggctcgcgcaggtatacgagagccggtttgccgaacacgggatc
cgcaccgcgcagattctcctcacgcatgcggatctcgccgaccgcgaacgctacctgaac
gcgcgctcgacgctcctcacgctgctgcggctcggcgtcgtgccgatcatcaacgagaac
gacaccgtcgtcaccgacgaaatcaagttcggcgacaacgacacgctcggcgcgctcgtc
gcgaatctgatcgaaggcgatacgctcgtcatcctgaccgaccagccggggctgttcacg
gccgatccgcgcaaggatccgggcgcgacgctcgttgccgaggcgagcgccggtgcgccg
gagctcgaagcgatggcgggcggtgcgggctcgagcatcggccgcggcggcatgctgacg
aagattctcgcagccaagcgcgccgcgcacagcggcgcgaacaccgtgatcgcgagcggc
cgcgagcgcgacgtgctcgtgcggctcgcggccggcgaggcgatcggcacgcaactgatc
gcgcgcaccgcgcggatggcggcgcgcaagcaatggatggcggaccacctgcaggtacgt
ggccatgtcgttatcgatgcgggggcggtcgacaagttgacggcggggggcaagagcctg
ttgccgatcggcgtcgtcgccgtgcagggcgtgttcgcgcgcggcgaagtgatcgcgtgc
gtcgacgacaccggccgtgaagtcgcgcgcgggatcaccaattacagcagcgccgaaacg
aagctgatccagcgcaagccgagcggcgagatcgaaacggtgctcggctacatgctcgag
cccgagctgatccatcgggacaatctcgtgctggtctga

DBGET integrated database retrieval system