KEGG   Burkholderia mallei ATCC 23344: BMA2991Help
Entry
BMA2991           CDS       T00204                                 

Gene name
sdaA
Definition
L-serine ammonia-lyase (EC:4.3.1.17)
Orthology
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:bma01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bma01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bma00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bma00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1:complement(3093517..3094905)
Genome map
AA seq 462 aa AA seqDB search
MAVSVFDLFKIGIGPSSSHTVGPMRAALMFAQGLERDALLAATASVKVELYGSLGATGKG
HGTDRGVMLGLMGDAPDTVDPSTIAARLDAVRTSKTLALLGTHPVPFVPKEHIAFYRQAL
PEHPNAMKLRAADTAGAVLREATYLSVGGGFVVTSGAPNTKVLAAAEQMPHPFRTGAELL
ALTASTGKSIAQLMWENERAWHTEEETRTGLLKIWDVMQSCVARGCEIGNPDADGNLPGP
FQVKRRAPQLYRTLTGHPERALQDPLSMVDWINLYAIAVNEENAAGGRVVTAPTNGAAGI
IPAVLHYYTRFTPGANEQGVIDFLMTAAAIGILYKLNASISGAEVGCQGEVGVACSMAAG
ALAAVLGGTPQQVENAAEIGMEHNLGLTCDPVGGMVQIPCIERNAMASVKAVNAARMALR
GDGSHYVSLDSVIKTMRETGADMKTKYKETSRGGLAVNIVEC
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcagcgtgttcgatcttttcaaaatcggtatcggcccttcgagctcgcatacg
gtcgggccgatgcgcgccgcactgatgttcgcgcaagggctcgagcgcgacgcgctgctc
gccgcgaccgcgagcgtgaaggtcgagctgtacggctcgctcggcgcgaccggcaagggc
cacggcaccgatcgcggcgtgatgctcggcctgatgggcgacgcgcccgacaccgtcgat
ccgtcgacgatcgccgcgcggctcgacgcggtgcgcacctcgaaaacgctcgcgctgctc
ggcacgcatccggtaccgttcgtgccgaaggaacacatcgcgttctaccggcaggcgctg
cccgagcacccgaacgcgatgaagctgcgcgcggccgacacggcgggcgcggtgctgcgc
gaggcgacgtatctttcggtgggcggcggcttcgtcgtcacctcgggcgcgccgaacacg
aaagtgctcgccgccgccgaacagatgccgcacccgtttcgcacgggcgccgagttgctc
gcgctcaccgcgtcgaccggcaagtcgatcgcgcagctgatgtgggagaacgagcgcgcg
tggcacaccgaggaggaaacgcgcacgggcctgctgaagatctgggacgtgatgcaatcg
tgcgtcgcgcgcggctgcgaaatcggcaaccccgacgcggacggcaacctgcccgggccg
ttccaggtcaagcgccgcgcgccgcagctctatcgcacgctgacgggccatccggaacgc
gcgctgcaggacccgctgtcgatggtcgactggatcaacctgtatgcgatcgcggtcaac
gaggaaaacgcggcgggcgggcgcgtcgtcaccgcgccgaccaacggcgcggcgggcatc
atcccggccgtcctccattactacacgcgcttcacgccgggcgcgaacgagcagggcgtg
atcgatttcctgatgaccgcggcggcgatcggcatcctctacaagctcaacgcatcgatc
tcgggtgccgaagtcggctgtcagggcgaagtcggcgtcgcgtgctcgatggcggcgggc
gcgctcgccgcggtgctgggcggcacgccgcagcaggtcgagaacgcggccgagatcggg
atggagcataacctcggcctcacctgcgatccggtcggcgggatggtgcagattccgtgc
atcgagcgcaacgcgatggcgtcggtgaaggccgtcaacgccgcgcgaatggcgctgcgc
ggcgacggcagccactacgtgtcgctcgactccgtgatcaagacgatgcgcgaaaccggc
gcggacatgaagacgaagtacaaggagacctcgcgcggcgggctcgcggtgaatatcgtc
gagtgctga

DBGET integrated database retrieval system