KEGG   Burkholderia mallei ATCC 23344: BMA2991Help
Entry
BMA2991           CDS       T00204                                 

Gene name
sdaA
Definition
L-serine ammonia-lyase (EC:4.3.1.17)
Orthology
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMA2991 (sdaA)
   01230 Biosynthesis of amino acids
    BMA2991 (sdaA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMA2991 (sdaA)
   00270 Cysteine and methionine metabolism
    BMA2991 (sdaA)
Enzymes [BR:bma01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     BMA2991 (sdaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3093517..3094905)
Genome map
AA seq 462 aa AA seqDB search
MAVSVFDLFKIGIGPSSSHTVGPMRAALMFAQGLERDALLAATASVKVELYGSLGATGKG
HGTDRGVMLGLMGDAPDTVDPSTIAARLDAVRTSKTLALLGTHPVPFVPKEHIAFYRQAL
PEHPNAMKLRAADTAGAVLREATYLSVGGGFVVTSGAPNTKVLAAAEQMPHPFRTGAELL
ALTASTGKSIAQLMWENERAWHTEEETRTGLLKIWDVMQSCVARGCEIGNPDADGNLPGP
FQVKRRAPQLYRTLTGHPERALQDPLSMVDWINLYAIAVNEENAAGGRVVTAPTNGAAGI
IPAVLHYYTRFTPGANEQGVIDFLMTAAAIGILYKLNASISGAEVGCQGEVGVACSMAAG
ALAAVLGGTPQQVENAAEIGMEHNLGLTCDPVGGMVQIPCIERNAMASVKAVNAARMALR
GDGSHYVSLDSVIKTMRETGADMKTKYKETSRGGLAVNIVEC
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcagcgtgttcgatcttttcaaaatcggtatcggcccttcgagctcgcatacg
gtcgggccgatgcgcgccgcactgatgttcgcgcaagggctcgagcgcgacgcgctgctc
gccgcgaccgcgagcgtgaaggtcgagctgtacggctcgctcggcgcgaccggcaagggc
cacggcaccgatcgcggcgtgatgctcggcctgatgggcgacgcgcccgacaccgtcgat
ccgtcgacgatcgccgcgcggctcgacgcggtgcgcacctcgaaaacgctcgcgctgctc
ggcacgcatccggtaccgttcgtgccgaaggaacacatcgcgttctaccggcaggcgctg
cccgagcacccgaacgcgatgaagctgcgcgcggccgacacggcgggcgcggtgctgcgc
gaggcgacgtatctttcggtgggcggcggcttcgtcgtcacctcgggcgcgccgaacacg
aaagtgctcgccgccgccgaacagatgccgcacccgtttcgcacgggcgccgagttgctc
gcgctcaccgcgtcgaccggcaagtcgatcgcgcagctgatgtgggagaacgagcgcgcg
tggcacaccgaggaggaaacgcgcacgggcctgctgaagatctgggacgtgatgcaatcg
tgcgtcgcgcgcggctgcgaaatcggcaaccccgacgcggacggcaacctgcccgggccg
ttccaggtcaagcgccgcgcgccgcagctctatcgcacgctgacgggccatccggaacgc
gcgctgcaggacccgctgtcgatggtcgactggatcaacctgtatgcgatcgcggtcaac
gaggaaaacgcggcgggcgggcgcgtcgtcaccgcgccgaccaacggcgcggcgggcatc
atcccggccgtcctccattactacacgcgcttcacgccgggcgcgaacgagcagggcgtg
atcgatttcctgatgaccgcggcggcgatcggcatcctctacaagctcaacgcatcgatc
tcgggtgccgaagtcggctgtcagggcgaagtcggcgtcgcgtgctcgatggcggcgggc
gcgctcgccgcggtgctgggcggcacgccgcagcaggtcgagaacgcggccgagatcggg
atggagcataacctcggcctcacctgcgatccggtcggcgggatggtgcagattccgtgc
atcgagcgcaacgcgatggcgtcggtgaaggccgtcaacgccgcgcgaatggcgctgcgc
ggcgacggcagccactacgtgtcgctcgactccgtgatcaagacgatgcgcgaaaccggc
gcggacatgaagacgaagtacaaggagacctcgcgcggcgggctcgcggtgaatatcgtc
gagtgctga

DBGET integrated database retrieval system