KEGG   Burkholderia mallei ATCC 23344: BMA3208Help
Entry
BMA3208           CDS       T00204                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMA3208 (gpmA)
   01230 Biosynthesis of amino acids
    BMA3208 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA3208 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BMA3208 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMA3208 (gpmA)
Enzymes [BR:bma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BMA3208 (gpmA)
Exosome [BR:bma04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BMA3208 (gpmA)
  Exosomal proteins of melanoma cells
   BMA3208 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1:3309584..3310333
Genome map
AA seq 249 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKR
AIRTLWHVQDQMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTP
PPALEPGDERAPYADPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIA
AHGNSLRALIKYLDGISDADIVGLNIPNGVPLVYELDESLTPIRHYYLGDQEAIAKAQAA
VAQQGKSAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
accggctgggtcgatgtcgacctgaccgaacaaggcaaccgcgaagcccggcaggcgggc
cagctcctgaaggaagccggctacacgttcgatatcgcatacacgtcggtgctcaagcgc
gcgatccgcacgctctggcacgtgcaggaccagatggatctgatgtacgtgcccgtcgtg
cattcgtggcgcctgaacgagcgccattacggcgcgctgtcgggcctgaacaaggcggag
acggccgcgaagtacggcgacgagcaggtgctcgtctggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgggcgacgagcgcgcgccgtacgccgatccgcgctacgcgaag
gtgccgcgcgagcagttgccgctcaccgagtgcctgaaggacacggtcgcgcgcgtgctg
ccgctctggaacgaatcgatcgcgcccgcggtgaaggccggcaagcaggtgctgatcgcc
gcgcacggcaactcgctgcgcgcgctgatcaagtatctcgacggcatctccgacgcggac
atcgtcggcctgaacatcccgaacggcgtgccgctcgtctacgagctcgacgagagcctc
acgcccatccggcactactacctcggcgatcaggaggcgatcgcgaaggcgcaggccgcc
gtcgcgcagcagggcaagtccgcggcgtaa

DBGET integrated database retrieval system