KEGG   Burkholderia mallei ATCC 23344: BMAA0117Help
Entry
BMAA0117          CDS       T00204                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMAA0117 (pfk)
   01230 Biosynthesis of amino acids
    BMAA0117 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMAA0117 (pfk)
   00030 Pentose phosphate pathway
    BMAA0117 (pfk)
   00051 Fructose and mannose metabolism
    BMAA0117 (pfk)
   00052 Galactose metabolism
    BMAA0117 (pfk)
  Energy metabolism
   00680 Methane metabolism
    BMAA0117 (pfk)
Enzymes [BR:bma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BMAA0117 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
2:114189..115130
Genome map
AA seq 313 aa AA seqDB search
MPEIVTLTPNPAIDVATCVERVTDTRKLRCGPARRDPGGGGINVARVLTRLGADCSAVYL
AGGGTGLALRGLLADEGVRAHGIDIAGETRENFSVLETSTGREFRFVLPGPALAAHEWPR
CVEALGRLADASRYLVMSGSLPPGMPDDCYARLARRASARGVRTVVDTSGPALAAALDAG
VYLVKPSLGELRALTGLPLEDDGARLAAARAIVAGGRAQIVALTLGDAGALVVSRDDAVR
LPGVKVAVRSAIGAGDSFVAGLVAALNRGANVADAARHALAAASASLLSTGPALGTKEDI
ARIYRELPGTIDA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaatcgtcaccctcacgccgaatcccgccatcgacgtcgcgacgtgcgtcgag
cgagtcaccgacacccgcaagctgcgctgcggccccgcacgacgcgatccgggcggcggc
ggaatcaatgtcgcccgcgtgctgacgcgcctcggcgccgattgttcggccgtctacctg
gcgggcggcggcaccggcctcgcgctgcgcggcctgctcgccgacgaaggcgtgcgggcg
catggcatcgacatcgccggcgagacgcgcgaaaacttttcggtgctcgaaacgtcgacg
ggccgcgaattccgcttcgtgttgcccgggccggcgctcgcggcgcacgaatggccgcgc
tgcgtcgaagcgctcgggcggctcgccgacgcgtcgcgctatctggtgatgagcggcagc
ctgccgcccggcatgccggacgattgctacgcccggctcgcgcggcgcgcgagcgcgcgc
ggcgtgcgcacggtcgtcgatacgtcgggaccggcgctcgccgccgcgctcgatgcgggc
gtctatctggtgaagccgagcctcggcgagttgcgcgcgctgaccggcctgccgctcgaa
gacgacggcgcgcgccttgccgccgcgcgcgcgatcgtcgccggcgggcgcgcgcagatc
gtcgcgctgacgctcggcgacgcgggcgcgctcgtcgtgtcgcgcgacgatgcggtgcgt
ctgccgggcgtgaaggtggcggtgcgcagcgcgatcggcgcgggcgacagcttcgtcgcg
gggctcgtcgccgcgctcaatcgcggcgcgaacgtcgccgacgcggcgcgccatgcgctc
gccgccgcgtcggcgtcgctgctgagcacgggccccgcgctgggcacgaaggaagacatc
gcgcggatctatcgcgaactgccggggacgatcgacgcgtga

DBGET integrated database retrieval system