KEGG   Burkholderia mallei ATCC 23344: BMAA0132Help
Entry
BMAA0132          CDS       T00204                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BMAA0132
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMAA0132
  Lipid metabolism
   00071 Fatty acid degradation
    BMAA0132
  Amino acid metabolism
   00350 Tyrosine metabolism
    BMAA0132
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BMAA0132
   00626 Naphthalene degradation
    BMAA0132
Enzymes [BR:bma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BMAA0132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
2:128106..129131
Genome map
AA seq 341 aa AA seqDB search
MAQYMKAAVVHAFGEPLRIEEVPVPTPGAGQILVNVKASGVCHTDLHAADGDWPVKPTLP
FIPGHEGVGFVAAVGEGVRHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSV
NGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGL
GHVAVQYAKAMGLHVVAVDVAPQKLELARKLGATFVVDASKDDPAAVIQKEIGGVHGVLV
TAVSRGAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAAEGLVRAHIHRDKLEHINGVFSALREGKVDGRIVLTGQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaatacatgaaggccgcggtggtgcatgcattcggcgaaccgcttcggatcgag
gaggtgcccgtgccgacgcccggcgcggggcagattctcgtgaacgtcaaggcatcgggc
gtgtgccataccgatctgcacgcggccgacggcgactggcccgtcaagccgacgctgccg
ttcattccggggcacgagggcgtcggcttcgtcgcggcggtgggcgaaggcgtgaggcac
gtgaaggagggcgatcgcgtcggcgtgccttggctctataccgcgtgcggccattgcgag
tattgccagaccggctgggagacgctgtgccacgagcagcagaacaccggctattcggtg
aacggcagctacgcggaatacgtgctcgccgatccgaactacgtcggccatctgccgagc
aacgtcgcgttcgacgagatcgcgccgatcctgtgcgcgggcgtgaccgtctacaagggc
attcgggtgaccgacacgcgcccggggcaatggatcgcgatctcggggatcggcgggctc
gggcacgtcgcggtgcagtacgcgaaggcgatggggctgcacgtggtcgcggtggacgtc
gcgccgcagaagctcgagcttgcgcgcaagctgggcgcgacgttcgtcgtcgatgcgtcg
aaggacgatccggcggcggtgatccagaaggagatcggcggcgtgcacggcgtgctcgtg
acggccgtgtcgcgcggcgcgttcgcgcaggcgctcggcatggtgaggcgcggcgggacg
gtctcgctgaacgggctgccgccgggcgattttccgctgccgatcttctcgacggtgctc
aacgggatcacggtgcgaggctcgatcgtcggcacgcggcgcgatctccaggaatcgctc
gatttcgcggccgaagggctcgtgcgcgcgcatatccatcgcgacaagctcgagcacatc
aacggcgtgttctcggcgctgcgtgaagggaaggtcgacgggcggatcgtgttgaccggg
caatga

DBGET integrated database retrieval system