KEGG   Burkholderia mallei ATCC 23344: BMAA0367Help
Entry
BMAA0367          CDS       T00204                                 

Definition
acetyltransferase
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMAA0367
   00620 Pyruvate metabolism
    BMAA0367
   00640 Propanoate metabolism
    BMAA0367
Enzymes [BR:bma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     BMAA0367
Lipid biosynthesis proteins [BR:bma01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BMAA0367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:353749..356112
Genome map
AA seq 787 aa AA seqDB search
MTVRNLDALFHPTSVAVVGASPRPGSVGAMVWACVLDGRFSGAIWPVNPKYGELNGHKVY
PYVDQLPSAPSVALICTPPATWPGIVRKLGGLGVRAAIIVGEARSGADRAALERALAAAK
PYLLRVVGPGSLGVVSPALGAHFGAPACIVKAGGVAWVSQSNALTNAVLGWAHARGLGFS
HAVALGGEADVDAADVLDYLASDAETRAILLELDTVKSARKFMSAARAAARNKPVLALRA
GRGDSGDLLYTAAFQRAGMVRVDALDDLLDEIEALGVGRAAATSGGVTLVTSDRGVAKLA
VDALAAAGETLAQWPRAAVDEVGGALPAGIVAGNPLLLGDDARPEYFGAALKALAQHPPT
GTVFVVHATSHSAPAVDVARVLIESRKFARRGMLACFFGGVDAATRDALHVHGIPVHTTP
QRLARAHARLVDYQLGRELLMQTPEGTPPQPAASISAARHTARAALAQGRDGFEGDAALE
WLAGFGIERATDADVDMGDTIVDITVGMYDDPNFGPVFRYSVPPADGVSAPFVVYGLPPF
NTVLARAVVARSPYAHRAPPEPLLQALTALSQAVCDVREIVEMSLVLRVRPTRVVALGPH
IRLATGRSRLAIVPYPRYLEQQLDWRGERITVRPIRPEDEAAHRELLSAMTPDDLRMRFF
GAIRNFDHSQIARMTQIDYDREMALIATLDDADGRAHTLGAVRAVTDPDNEATEFAIAVR
PDQKGKGLGRMLMTRIIDYARSRGTAWMIGEALRENTAMISLAKDSGFAVSSTEEPGVVA
FRLKLQP
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgttcgcaatctcgatgcgttgttccatccgacatccgttgccgtcgtcggcgct
tcgccgcgcccgggcagcgtcggcgcgatggtgtgggcgtgcgtgcttgacggccggttc
agcggcgcgatctggcctgtcaacccgaagtacggcgaactgaacggccacaaggtttat
ccctatgtcgaccagctgccgagcgcgccgtcggtcgcgctcatatgcacgccgcccgcg
acgtggcccggcatcgtgcgcaagctgggcggcctgggcgtgcgtgcggcgatcatcgtc
ggcgaggctcgttcgggcgcagaccgggccgcgctggaacgggcgctcgccgcggcgaag
ccatatctgctgcgcgtcgtcgggccgggcagcctgggcgtggtgtcgcccgcgctgggc
gcgcatttcggcgcgccggcgtgcatcgtcaaggcgggtggcgtcgcatgggtgtcgcaa
tcgaatgcgctgacgaacgcggtgctcggctgggcgcatgcgcgcgggctcggtttctcg
catgcggtcgcactcggcggcgaggcggatgtcgacgcggccgacgtgctcgactacctg
gcgagcgatgccgagacacgcgcgatcctgctcgagctcgacacggtgaaatcggcgcgc
aagttcatgtcggcggcgcgcgccgcggcgcgcaacaagccggtgcttgcgttgcgcgcg
gggcgcggcgattcgggcgacctgctttacacggccgcgtttcagcgcgcggggatggtg
cgcgtcgacgcgctcgacgatcttctcgacgagatcgaggcgctcggcgtcggccgtgcc
gcggcgacgagcggcggggtgacgctcgtcacgagcgacaggggcgtcgcgaagcttgcc
gtcgacgcactcgcggcggcgggggaaacgctggcgcaatggccgcgggcggccgtcgac
gaagtcggcggcgcgctgcccgcgggcatcgtcgccggcaatccgttgctgctcggcgac
gacgcgcggcccgaatatttcggcgcggcgctgaaggcgctcgcgcagcatccgccgaca
ggcaccgtgttcgtggttcatgcgacgtcgcatagcgcgcctgccgtcgacgtcgcacgt
gtgctgatcgaatcgcgcaagttcgcgcgtcgcggcatgctcgcgtgcttcttcggcggc
gtcgacgccgcgacgcgcgacgcgctgcacgtgcacggcatccccgtgcacacgacgccg
cagcgtctcgcgcgcgcgcatgcgcgccttgtcgattatcaattgggccgggagctgttg
atgcagacgccggagggcacgccgccgcaaccggcggcgtcgatctcggccgcgcggcac
acggcgcgcgcggcgctcgcgcaggggcgcgacgggttcgaaggcgacgcggcgctcgaa
tggctggcgggtttcggcatcgagcgcgcgaccgacgcggacgtcgacatgggcgatacg
atcgtcgacatcacggtcgggatgtacgacgacccgaacttcgggccggtattccgctat
tcggtgccgccggcggatggcgtgtccgcgccgttcgtcgtctacgggctgccgcctttc
aataccgtgctcgcgcgcgcggtcgtcgcgcgatcgccgtatgcgcatcgcgcgccgccc
gagccgcttctgcaggcactgaccgcgctttcgcaggcggtgtgcgatgtgcgcgaaatc
gtcgagatgtcgctcgtgctgcgcgtgcggcccacacgcgtggtcgcgcttgggccgcac
atcaggctcgcgacggggcgcagccggctcgcgatcgtgccatatccgcgctatctcgag
cagcagctcgactggcgcggagaacgcatcacggtgcgtccgattcgccccgaggacgag
gccgcgcatcgcgagctgctgagcgcgatgacgccggacgatctgcgaatgcgcttcttc
ggtgcgatacgcaacttcgaccattcgcagatcgcgcggatgacgcagatcgattacgac
cgcgagatggcgctgatcgcgacgctcgacgatgccgacggccgcgcgcatacgctcggc
gcggtgcgcgcggtgaccgatccggacaacgaagcgacggagttcgcgatcgcggtgcgg
cctgaccaaaagggcaaggggctcggacggatgttgatgacgcgcatcatcgactacgcg
cgctcgcgcggaacggcgtggatgatcggcgaggcactgcgcgagaacacggcgatgatc
tcgctcgcgaaggatagcggttttgcggtgtcgtcgaccgaggagcctggggtggtggcg
ttccggctgaagctgcagccgtga

DBGET integrated database retrieval system