KEGG   Burkholderia mallei ATCC 23344: BMAA0468Help
Entry
BMAA0468          CDS       T00204                                 

Gene name
fdhA
Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bma01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:bma00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bma00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
2:475857..477056
Genome map
AA seq 399 aa AA seqDB search
MSSNRGVVYQGPGKVEVRKIDYPKMVDPSGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVIEVGRDAETLKIGDLVSVPFNVACGRCAMCKEQHTGVCLNVNPARA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDRAMAKIRDLTCLSDILPTGYHGAV
TAGVKPGSTVYVAGAGPVGMAAAASARLLGAACTIVGDMNAERLAHAKAMGFEVVDLSKD
ATLGEQIEQILGKPEIDCAVDCVGFEAHGHGSSGHAQEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAVDVAAKHGSLSIRFGLGWAKSHSFHTGQTPVLKYSRNLMQAILFDRLPIA
EIVNVAVISLDDAPEGYKKFDGGAPRKFVIDPHGMLKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaccgaggtgtcgtgtatcaggggccgggcaaggtcgaagtgcggaagatc
gactatccgaagatggtcgatccgagcggccgcgcgatcggccacggcgtgatcctgaag
gtcgtcagcacgaatatctgcggctccgatcagcacatggtgcgcggccgcacgacggcg
cccgtcggtctcgtgctcggccacgagatcacgggcgaggtgatcgaggtcggccgcgat
gccgagacgctgaagatcggcgatctcgtatcggtgccgttcaacgtcgcgtgcggccgc
tgcgcgatgtgcaaggagcagcacacgggcgtgtgcctgaacgtgaatccggcgcgcgcg
ggcggcgcgtacggctatgtcgacatgggcggctggatcggcgggcaagccgaatacgtg
ctcgtgccgtacgccgacttcaacctgctgaaattccccgatcgcgatcgggccatggcg
aagatccgcgatctcacgtgcctgtcggacatcctgccgaccggctatcacggcgcggtc
acggccggcgtgaagcccggctcgacggtttacgtcgcgggcgcgggcccggtggggatg
gcggccgccgcgtcggcgcggctgctcggcgccgcatgcacgatcgtcggcgacatgaac
gccgagcgcctcgcgcacgcgaaggcgatgggcttcgaggtggtcgatctgtcgaaggac
gcgacgctcggcgagcagatcgagcaaatcctcggcaagccggagatcgattgcgcggtt
gactgcgtcggcttcgaggcgcacggccacggctcgtccggccatgcgcaggaggcgccc
gcgacggtgctgaactcgctgatggaaatcacccggcccgcgggcgcgatcggcattccg
ggcctgtacgtgaccgacgatccgggcgccgtcgatgtcgccgccaagcacggcagcctg
agcattcgtttcggtctcggctgggcgaaatcgcattcgttccataccggccagacgccc
gtgctcaagtacagccgcaacctgatgcaggcgatcctgttcgaccggctgccgatcgcg
gaaatcgtcaacgtggcggtgatttcgctcgacgacgcgccggagggctacaagaagttc
gacggcggcgcgccgcgcaaattcgtcatcgatccgcacgggatgctgaaggcggcctga

DBGET integrated database retrieval system