KEGG   Burkholderia mallei ATCC 23344: BMAA0525Help
Entry
BMAA0525          CDS       T00204                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bma  Burkholderia mallei ATCC 23344
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
2:534732..535469
Genome map
AA seq 245 aa AA seqDB search
MICMKKTIRIAALALAAATATLGCTAQADQSTDKLKAALQSRLGADAPIKSVTKSPIAGL
YEVNLGSQIVYSDASGDYVLLGELVNTKTHKNLTAERLAEINKIDFASLPLSNAIKVVKG
NGARKIAVFSDPNCPYCKKLETTLQSVDNVTVYTFLYPVLSPDSTVKSKSIWCASDRVKS
WQSWMLEHRAPTSAANCDTTALDKNLALGRGMNVTGTPTVFLADGTRLPGAVSADELNQA
LAGVK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgatttgcatgaaaaaaacgattcgtatcgccgcgctcgccctggctgccgcgacggcg
acgctcggctgcaccgcgcaggccgaccagtccaccgacaagctgaaggccgcgctgcaa
tcgcgcctcggcgccgacgcgccgatcaagagcgtgacgaagtcgccgattgcgggtttg
tacgaggtcaatctcggctcgcagatcgtctatagcgacgcatcgggcgattacgtgctg
ctcggcgagctcgtcaacacgaagacgcacaagaacctcacggccgagcgcctcgccgag
atcaacaagatcgatttcgcgagcctgccgctgtcgaacgcgatcaaggtcgtgaagggc
aacggcgcgcgcaagatcgcggtgttctccgatccgaactgcccgtactgcaagaagctc
gagacgacgctgcaatcggtcgacaacgtgaccgtctacacgttcctgtatccggtgctg
tcgcccgattcgacggtgaagtcgaagtcgatctggtgcgcgagcgaccgcgtgaagagc
tggcagtcgtggatgctcgagcatcgcgcgcccacgagcgcggcgaactgcgacacgacc
gcgctcgacaagaacctcgcgctcggccgcggaatgaacgtgacgggcacgccgaccgta
ttcctcgccgacggcacgcgcctgccgggcgccgtatccgccgacgaactgaatcaggcg
ctcgccggcgtcaagtga

DBGET integrated database retrieval system