KEGG   Burkholderia mallei ATCC 23344: BMAA0610Help
Entry
BMAA0610          CDS       T00204                                 

Definition
di-heme cytochrome c peroxidase family protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bma  Burkholderia mallei ATCC 23344
Brite
Enzymes [BR:bma01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BMAA0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(620338..621948)
Genome map
AA seq 536 aa AA seqDB search
MRRARSARRRPHATRARYITDARPAGARNAGRHSGATHAGFFFCMITTERSSMAEPLCAQ
PAPSTRSDACTPAALATVSRRRGRRNACAMRHAPAAAAFGALGFAAFALAFPEHVPNAVG
AIVENLTGANPQPVALRRPGAEPLSAVAQLGRALFFDPALSASGRQSCASCHSPDHAYGP
PNDLDVQLGGAALTQPGYRPPPSLMYLYRQPNFSIGPDSSENDDAASVAQQAASAAGAVR
ARKSAGAAAAPQLVPQGGMFWDGRADTLQQQAFGPLMNPVEMANASTGDVARKLAHARYA
PRFRQLFGPRIFDDARLAVSEAMFAIARYQVEDPSFHPYSSKYDRWLEGDARLTQAELRG
MRRFNDPNKANCAGCHLSKPSADGLPPMFTDFQYEALGVPRNRALAQNRNPAFHDLGICG
PFRDNLKTQTQYCAMFATPSLRNVATRRVFFHNGVYHSLDRVLAFYNLRSVDPGKIYPRD
ASGRVLQYDDIPSAYRANVDVADAPFDRKPGDAPAMTEQDMRDIVAFLNTLTDEKR
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcgcacgctcggcgcggcgccgcccgcacgcgacgcgcgcccgatacatcacc
gatgcacggccggccggcgcacgcaacgccggccgtcattccggcgcgacgcacgccgga
tttttcttttgcatgatcacgaccgaacgctccagcatggccgaaccgctttgcgcgcaa
cccgctccgtccacccgatccgacgcatgcacgccggccgcgcttgccaccgtctcgcgc
cgccgcggccgccgcaacgcgtgcgcgatgcgccacgcgccggcggccgccgcgttcggc
gcgctcggcttcgccgcgttcgcgctggcgtttcccgagcacgtgccgaacgcggtcggc
gcgatcgtcgaaaacctcacgggcgcgaatccgcagccggtcgcgctgcgccgcccgggc
gccgagccgctgagcgcggtcgcgcagctcggccgcgcgctgttcttcgatcccgcgctg
tccgcgtcgggccggcaatcgtgtgcgtcgtgccacagccccgatcatgcgtacggcccg
ccgaacgatctggacgtgcaactgggcggcgccgcgctgacgcagcccggctatcggccg
ccgccgtcgctgatgtatctgtaccggcagccgaacttcagcatcggcccggactcgtcc
gagaacgacgacgcggcgagcgtcgcgcaacaggccgcatccgcggcgggcgccgtgcgc
gcgcggaagagcgccggcgcggcggccgcgccgcagctcgtgccgcagggcgggatgttc
tgggacggccgcgcggatacgctgcagcagcaggcgttcggcccgttgatgaatccggtc
gagatggcgaacgcgagcaccggcgacgtcgcgcgcaagctcgcgcacgcgcgctacgcg
ccgcggttccggcagttgttcggcccgcgcatcttcgacgacgcacgtcttgcggtgtcc
gaagcgatgttcgcgatcgcgcgctaccaggtggaggacccgtcgttccatccgtattcg
agcaagtacgaccgctggctcgaaggcgacgcgcggctcacgcaggcggagctgcgcggc
atgcggcgcttcaacgatccgaacaaggcgaattgcgcgggctgccacctgtcgaagccg
agcgcggacggtctgccgccgatgttcaccgatttccagtacgaggcgctcggcgtgccg
cgcaaccgcgcgctcgcgcagaaccgcaatccggcgttccacgatctcggcatctgcggg
ccgtttcgcgacaacttgaagacgcagacgcaatactgcgcgatgttcgcgacgccttcg
ctgcgcaacgtcgcgacgcgccgcgtgttcttccacaacggcgtctatcattcgctcgac
cgggtgctcgcgttctacaacctgcgcagcgtcgatccgggcaagatctatccgcgcgac
gcaagcggccgggtgctgcaatacgacgacatcccgagcgcgtatcgcgcgaacgtcgac
gtcgccgatgcgccgttcgaccgcaagccgggcgacgcgcccgcgatgaccgagcaggac
atgcgcgacatcgttgcgtttctgaacacgctgaccgacgagaagcgctga

DBGET integrated database retrieval system