KEGG   Burkholderia mallei ATCC 23344: BMAA0876Help
Entry
BMAA0876          CDS       T00204                                 

Gene name
bdhA-2
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BMAA0876 (bdhA-2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BMAA0876 (bdhA-2)
Enzymes [BR:bma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BMAA0876 (bdhA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
2:897684..898487
Genome map
AA seq 267 aa AA seqDB search
METWGMTSNLNGKAAIVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVAELIEQAG
GRAIGVAMDVTNEDAVNAGIDKVAQTFGSVDILVSNAGIQIVNPIENYAFADWKKMQAIH
VDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEG
AKHNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGQTVDGVFTTVEDVAK
TVLFLSAFPSAALTGQSFVVSHGWFMQ
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggagacttggggaatgacttcgaacttgaacgggaaggcggccatcgtgacgggcgcg
gcgagcggcatcggcaaggaaatcgcgctggagctcgcgcgcgcgggcgcggcggtggcg
atcgccgatctgaaccaggacggcgcgaacgcggtggccgagctcatcgagcaggcgggc
ggccgggcgatcggcgtggcgatggacgtgacgaacgaggacgcggtgaacgccggcatc
gacaaggtcgcccagacgttcggctcggtcgacattctcgtgtcgaacgcgggcatccag
atcgtcaatccgatcgagaactatgcgttcgccgactggaagaagatgcaggcgattcac
gtcgacggcgcgttcctgacgacgaaggccgcgctcaagcacatgtacaaggacgatcgc
ggcggagtggtgatctacatgggctcggtgcattcgcacgaggcgtcgccgctgaagtcg
gcgtacgtgacggccaagcacgggctgctggggcttgcgcgcgtgctggcgaaggaaggc
gcgaagcacaacgtgcgctcgcatgtggtgtgcccgggcttcgtgcgcacgccgctcgtc
gacaagcagattccggagcaggccaaggagctcggcatcagcgaagaggaggtggtgaag
aaggtgatgctcggccagacggtggacggcgtgttcacgacggtcgaggacgtcgcgaag
acggtgctgttcctgtccgcgttcccgagcgcggcgctcaccggccagtcgttcgtcgtc
agccacggctggttcatgcagtaa

DBGET integrated database retrieval system