KEGG   Burkholderia mallei ATCC 23344: BMAA1008Help
Entry
BMAA1008          CDS       T00204                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMAA1008
Enzymes [BR:bma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BMAA1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1037106..1038404
Genome map
AA seq 432 aa AA seqDB search
MHVLVVGAGIAGLAAAWQLKRGGCDVTVVEAAERAGGRIRSAPFHGHVIECGAQFPSSGY
RHLMPLFGEAGLDAQLVKTSPWAAFEHRGRLFRVHARRPWTIPASGLLGWRDSVRVSRAR
AALLARVRALDPNRYAAFAEFDDADAAHWAERAFGRAAVDAIFAPMIHGLYFQPLRGASR
ALLAAVTGFDGADTLAVAGGWQTLPVALAARLDVRYGTRVDALSAHANGVDACVGDRALR
FDAAIVATPATVARRLWRGQTDAQRALLATGYARCAHVAFGLAPGWRAPARLRRVYGALL
SPHARRVAALTFERGRGIGDGQGEVVSAMLGHAGASALRYASDDEIARVALDDLRTLLPG
VAEAVVATRVQRWDEAEPLSPVGRARAIAAYRASIDARPRVLLAGDYMGSPWTDGAAETG
RWAARRLLDARA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtactcgtcgtcggagcaggaatcgccgggctcgccgccgcctggcaactgaaa
cggggcggatgcgacgtgaccgtcgtcgaggccgccgaacgcgcgggcggccgcattcgc
agcgcgccgttccacggccatgtgatcgaatgcggcgcgcagtttccgtcctccggctat
cggcacttgatgccgctcttcggcgaggcggggctcgatgcgcaactcgtgaagacctcg
ccgtgggcggcgttcgagcatcgcgggcggctctttcgcgtgcatgcgcggcggccgtgg
acgatccccgcgagcggcctgctcggctggcgcgacagcgtgcgcgtgagccgggcgcgc
gctgcgctgctcgcgcgggttcgcgcgctcgatccgaaccgctatgcggcgttcgcggaa
ttcgacgatgccgacgcggcccactgggcggaacgcgcgttcgggcgcgcggcggtcgac
gcgatcttcgcgccgatgattcacgggctgtatttccagccgctgcgcggcgcgtcgcgc
gcgctgctcgcggccgtcaccggcttcgacggcgcggatacgctcgcggtcgcgggcggc
tggcagacgctgcccgtcgcgctcgcggcccggctcgacgtgcgctacggcacgcgggtc
gatgcgctgtcggcgcacgcgaacggcgtcgacgcgtgcgtcggcgatcgcgcgctgcgt
ttcgacgcggcgatcgtcgcgacgcccgcgaccgtcgcgcgccgcctctggcgcgggcag
accgacgcgcagcgcgcgctgctcgcgacgggctatgcacgctgcgcgcacgtcgcgttc
ggcctcgcgccgggctggcgcgcgcctgcgcggctgcgccgcgtgtacggcgcgctgctg
tcgccgcacgcgcgacgcgtcgcggcgctcacgttcgagcgcgggcgcgggatcggcgac
gggcagggcgaggtcgtatcggcgatgctcgggcatgcgggcgcgagcgcgctgcgctat
gcatcggacgacgagatcgcgcgcgtcgcgctcgacgacctgcgcacgctgttgccgggc
gtcgccgaggcggtcgtcgcgacgcgcgtgcagcgctgggacgaggccgagccgctgtcg
cccgtcggccgcgcgcgcgcgatcgccgcataccgcgcgagcatcgacgcgcgcccacgc
gtgctgctcgcgggcgactacatgggctcgccgtggaccgacggcgcggcggagacgggc
agatgggcggcgcgcaggctgctcgacgcgcgcgcatga

DBGET integrated database retrieval system