KEGG   Burkholderia mallei ATCC 23344: BMAA1589Help
Entry
BMAA1589          CDS       T00204                                 

Gene name
bcsC
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bma00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
Position
2:complement(1723566..1725110)
Genome map
AA seq 514 aa AA seqDB search
MARQAGRDEGVGRIGRIGRIGREAGDAREAAGAGEACGRRHARADAWARRASRASRGWRT
FWRGGGRGRVRAVVASVVASFSVMAFAAATLPVSWRVAAAAERTRSGGERAGGLRDTAGL
IEISAAAPASTPIPAAPRRFAQPFAQPARAFAVASACAPSWPRWDRFKRDFVSADGRVID
VGSADERTVSEGQAYGLFFALVANDRAAFDALLRWTEDNLAQGDLSARLPAWLWGRAADG
AWRVLDANAASDADLWLAYALLEAGRLWRERSYTARGALLAKRVLDEETATLPGLGLVLL
PGPMGFRPARDAWRLNPSYSPPQAIRGIGAHVPDDARWARLAAGVGRVLTDSAPRGFAPD
WALYRAGRGFEPDAETHAVSAYNAIRVYLWAGMLDAGDPLARPLVAHFAPFAEHVAAHGA
PPEAVDATTGAAAPRDGNAGFSAAAVPFLEARGERASADAQLARVARLERETASGYYANV
LTLFGLGWRDGRYRFAADGTLRVRWSEPCSTPAR
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcaagcggggcgagacgaaggcgtcgggcgcatcgggcgcatcgggcgcatc
gggcgtgaagcgggcgacgcgcgcgaggcggccggggcgggcgaggcgtgcgggaggcgc
cacgcgcgggccgacgcgtgggcgcggcgggcgtcgcgagcatcgcgcgggtggcgcacg
ttttggcgcgggggcgggcgtgggcgcgtgcgcgccgtcgtggcgagcgtcgtggcgagc
ttctcggtgatggcgttcgcggcggcgacgttgccggtgtcgtggcgcgtcgccgcggcg
gcggagcgtacgcgaagcggcggcgaacgcgcgggcgggctgcgcgacacggcgggcttg
atcgagatctcggcggcggcgccggcctcgacgccgatcccggcggcgccgcggcggttc
gcgcagccgttcgcgcagccggctcgcgcgttcgccgtcgcgagcgcctgcgcgccgtcc
tggccgcgctgggaccgtttcaagcgtgacttcgtatcggccgacggccgcgtgatcgac
gtcggctcggccgacgagcggaccgtatccgaggggcaggcgtacggccttttcttcgcg
ctcgtcgcgaacgaccgcgcggcgttcgacgcgctgctgcgctggaccgaggacaatctc
gcgcagggcgatctgagcgcgcgtctgcccgcgtggctgtggggccgcgcggccgacggc
gcgtggcgcgtgctcgatgcgaacgccgcgtccgacgccgatctgtggcttgcgtacgcg
ctgctcgaagcggggcgcttgtggcgcgagcgcagctacacggcgcgcggcgcgttgctc
gcgaagcgcgtgctcgacgaggagaccgcgacgctgccggggctcggtctcgtgctgctg
ccgggcccgatgggttttcggccggcgcgcgacgcgtggcggctgaatccgagctattcg
ccgccgcaggcgattcgcgggatcggcgcgcatgtgcccgacgacgcgcgctgggcgcgg
ctcgcggcgggcgtcggccgcgtgctgaccgacagcgcgccgcgcggcttcgcgccggac
tgggcgctgtatcgcgcgggccgcggcttcgagccggacgccgaaacgcatgcggtgagc
gcgtacaacgcgattcgcgtctatctgtgggcgggcatgctcgatgcgggcgatccgctg
gcgcggccgctcgtcgcgcatttcgcgccgttcgccgagcatgtcgccgcgcatggcgcg
ccgccggaggcggtcgatgcgacgacgggcgcggccgccccgcgcgacggcaatgccggg
ttttccgcggcggccgtgccgtttctcgaggcgcgcggcgagcgggcgagcgccgacgcg
cagctcgcgcgcgtcgcgcggctcgagcgcgagacggcgagcggctattacgcgaacgtg
ctgacgctgttcgggctcggctggcgcgacgggcgctaccggttcgcggccgacggcacg
ctgcgggtgcgatggagcgagccgtgctcgacgcccgcgcgttga

DBGET integrated database retrieval system