KEGG   Burkholderia mallei ATCC 23344: BMAA1597Help
Entry
BMAA1597          CDS       T00204                                 

Gene name
speB
Definition
(RefSeq) agmatinase
  KO
K12255  guanidinobutyrase [EC:3.5.3.7]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00330  Arginine and proline metabolism
bma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BMAA1597 (speB)
Enzymes [BR:bma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     BMAA1597 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase 2-Hacid_dh B12-binding_2
Motif
Other DBs
NCBI-GeneID: 3087421
NCBI-ProteinID: YP_106179
UniProt: A0A0H2WAS9
Position
2:1732430..1733383
Genome map
AA seq 317 aa AA seqDB search
MSDDYFQPQSGNAMPRFAGIATMMRLPQAASAAGLDACFVGVPFDLGTSNRTGARFGPRQ
IRSESVLLRPYNMATRAAPFDSLRVADLGDVATNPYNLADSIARIEAAYHAILAHGCRPV
TLGGDHTITLPILRAMHRRHGRVGLIHVDAHADVNDTMFGEKIAHGTPFRRALEEGLLDG
DRVVQIGLRGTGYAAEDFDWCRDQGFRVVQAEACWNRSLAPLMDEVRARVQGGPVYLSFD
IDGIDPAYAPGTGTPEIAGLTVPQGLEIVRGAWGLDIVGADLVEVAPPYDPFGTTALLGA
NLAYEMLCVLPGVARRA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgactacttccagccgcaaagcggcaacgcgatgccgcgcttcgccggcatc
gcgacgatgatgcggctgccgcaggcggcgagcgccgcggggctcgacgcgtgctttgtc
ggcgtgccgttcgatctcggcacgtcgaaccgcaccggcgcgcggttcggcccgcgccag
atccgcagcgaatccgtgctgctgcgcccgtacaacatggccacgcgcgcggcgccgttc
gattcgctgcgcgtcgccgatctcggcgacgtcgcgacgaacccgtacaacctcgccgat
tcgatcgcgcggatcgaggccgcgtaccacgcgatcctcgcgcacggctgccgcccggtc
acgctcggcggcgaccacacgatcacgctgccgatcctgcgtgcgatgcatcgccggcac
gggcgcgtcgggctcatccacgtcgacgcgcacgcggacgtcaacgacacgatgttcggc
gagaagatcgcgcacggcacgccgtttcgccgcgcgctcgaggaagggctgctcgacggc
gaccgcgtcgtgcagatcggcttgcgcggcaccggctatgcggccgaggatttcgactgg
tgccgcgatcagggctttcgcgtcgtccaagccgaggcgtgctggaaccgctcgctcgcg
ccgctgatggacgaagtgcgcgcgcgcgtgcaaggcggcccggtctatctgagcttcgac
atcgacggcatcgatccggcgtacgcgccgggcaccggcacgccggagatcgccggcctc
acggtgccgcagggcctcgagatcgtgcgcggcgcgtgggggctcgacatcgtcggcgcc
gatctcgtcgaggtcgcgccgccgtacgatccgttcggcaccaccgcgctgctcggcgcg
aacctcgcttacgagatgctctgcgtgctgcccggcgtggcgcggcgcgcgtga

DBGET integrated database retrieval system