KEGG   Burkholderia mallei ATCC 23344: BMAA1721Help
Entry
BMAA1721          CDS       T00204                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00260  Glycine, serine and threonine metabolism
bma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bma01100  Metabolic pathways
bma01110  Biosynthesis of secondary metabolites
bma01130  Biosynthesis of antibiotics
bma01230  Biosynthesis of amino acids
Module
bma_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMAA1721 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMAA1721 (trpB)
Enzymes [BR:bma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BMAA1721 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 3087616
NCBI-ProteinID: YP_106284
Position
2:complement(1880568..1881761)
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDRGHFGPYGGVFVAETLIHALDELRAAYEKFKNDPEFVAEYNRELKHFVGRPSP
IYHAQRWSETLGGAQIYLKREDLNHTGAHKVNNVIGQALLAKRMGKRRVIAETGAGQHGV
ATATICARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIERTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDAAVQLIGVEAAGDGLDTGHHAASLIAGSPGVLHGNRTYLLQDDDGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVGITDEEALKAFHDCCRIEGIIPALESSHAIAY
GAKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGITL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtataaccttcccgatgatcgcggccatttcggcccatatggcggcgtgttcgtcgcc
gaaacgctgattcacgcgctcgacgagctgcgtgccgcgtacgagaaattcaagaacgac
cccgagttcgttgccgaatacaaccgtgagctgaagcacttcgtcggccgtccgtcgccg
atctatcacgcgcagcgctggagcgagacgctcggcggcgcgcagatctacctgaagcgc
gaggacctgaaccacacgggcgcgcacaaggtgaacaacgtgatcggccaggcgctgctc
gccaagcgcatgggcaagcggcgcgtgatcgccgagacgggcgcgggccagcacggcgtc
gccaccgcgacgatctgcgcgcgcttcggcatggagtgcgtcgtctacatgggcgccgag
gacgtgcgccggcaggccgcgaacgtctaccggatgaagctgctcggcgcgaccgtcgtg
cccgtcgaatccggctcgcgcacgctgaaggatgcgttgaacgaggcgatgcgcgactgg
gtcacgaacatcgagcgcacgttctacatcatcggcacggtggcgggcccgcatccgtat
ccgatgatggtgcgcgacttccagcgcgtgatcggcgacgaatgcaaggtgcagatgccc
gagctcgccggccggcagcccgacgcggtgatcgcctgcgtcggcggcggctcgaacgcg
atgggcatcttctacccgtacatcgacgacgcggccgtccaattgatcggcgtcgaggcg
gcgggcgacgggctcgacaccggccatcacgcggcgtcgctgatcgccggcagcccgggc
gtgctgcacggcaaccgcacgtatctgctgcaggacgacgacggccagatcatcgagacg
cattcggtatcggccggcctcgactatccgggcgtcggccccgagcatgcctggctgaag
gacagcggccgcgcgcagtacgtcgggatcaccgacgaagaggcgctgaaggcgtttcac
gactgctgccggatcgaggggatcattcccgcgctcgaatcgagccacgcgatcgcctac
ggcgcgaagctcgcgccgacgctgccgaaggacaagatcctcctcgtcaacctgtcgggg
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcacgctctga

DBGET integrated database retrieval system