KEGG   Burkholderia mallei ATCC 23344: BMAA1748Help
Entry
BMAA1748          CDS       T00204                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00020  Citrate cycle (TCA cycle)
bma00190  Oxidative phosphorylation
bma00650  Butanoate metabolism
bma01100  Metabolic pathways
bma01110  Biosynthesis of secondary metabolites
bma01120  Microbial metabolism in diverse environments
bma01130  Biosynthesis of antibiotics
bma01200  Carbon metabolism
Module
bma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bma_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMAA1748 (sdhD)
   00650 Butanoate metabolism
    BMAA1748 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BMAA1748 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-GeneID: 3086770
NCBI-ProteinID: YP_106307
UniProt: A0A0H2WAL3
Position
2:complement(1907048..1907416)
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTASVMAIYTVILLVWFFIARDFSYEGWASIFA
TQWMKLATFVTLLSLFYHAWVGVRDIWMDYIKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaataaccgtatcggctcgaagcgcctcgtcgtcggcgcacactatggtctg
cgcgactggctggcgcagcgcgtcaccgcgagcgtgatggcgatctacaccgtcatcctg
ctcgtctggttcttcatcgcgcgcgatttctcgtacgagggctgggcgtcgatcttcgcg
acgcaatggatgaagctcgcgaccttcgtcacgctgctctcgctcttctatcacgcatgg
gtcggcgtgcgtgacatctggatggactacatcaagcccgtcggtgtgcgcctgctgctg
caatcgctgacgatcgtctggctgctcgcgtgcgcgggctacgctgcgcagattctctgg
agagtttaa

DBGET integrated database retrieval system