KEGG   Burkholderia mallei ATCC 23344: BMAA1768Help
Entry
BMAA1768          CDS       T00204                                 

Gene name
pepM
Definition
phosphoenolpyruvate phosphomutase (EC:5.4.2.9)
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BMAA1768 (pepM)
Enzymes [BR:bma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BMAA1768 (pepM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
2:1930680..1932368
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLTSPSLEFLMEAHNGLSARIVREAGFKDIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAQAGADAILIHSKLSRPDEILQFAREWSGRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIQDSETLVNVEERVASVNEIFRLQDADEYSAAERIYLSSS
ARASSAALVLAASRGNGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKQGVNDITVVGGYR
ADAIDTSGVKLVVNERHAQTGELASLACAAERLTGDTIISYGDLLFRSYILRDLAESEAQ
FSVVVDSSQTQPSNQSVRDFAFCSAADDRGLFGQKAYLRRVSSDASEAAPHGRWIGLLNV
RGAGVARLKAMLGTLQARDDFDALDLPALLNALVDAGEQIEVQYVHGHWRGVNDLDDFRR
AGDFAHGQTPYAEQNAGSGSAR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaaccgaacttcaccgaatcgcgcagcgcgcggctgcggcggatgctg
acgagcccgtcgctcgaattcctgatggaggcgcacaacggcctgtccgcgcgcatcgtc
cgcgaggcgggcttcaaggacatctgggcgtcggggctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaggcgagctggacacaggtggtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccggctcgtgagaaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagtttccgaaaaccaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggatttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggctggggcatggacgaggcgctgcgccgc
gcgaacgcgtatgcgcaggccggcgccgatgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcgcgagaatggagcggccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggcgggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcgtccgcttccgcgatgcaggcggtcgcccgcgaa
atccaggacagcgaaacgctcgtcaacgtcgaggaacgcgtggcgagcgtcaacgagatc
ttccggctgcaggacgccgacgaatactcggccgccgagcgcatctacctgtcgtcgagc
gcgcgcgcgtcgagcgcggcgctcgtgctcgccgcgagccgcggcaacgggctcgaggcc
gtcaccgaggacaagccgaaggtgatgctgccggtcgccggcaagccgctgttgcgctgg
ctcgtcgacggcttcaagaagcagggcgtgaacgacatcacggtcgtcggcggctaccgc
gccgatgcgatcgacacgtccggcgtgaagctcgtcgtcaacgagcggcacgcgcaaacg
ggcgagctcgcgtcgctcgcctgcgcggccgagcgtctgacgggcgacaccatcatctcg
tacggcgatctgctgtttcgcagctacatcctgcgcgacctcgcggaaagcgaggcgcag
ttcagcgtcgtcgtcgattcgtcgcagacgcagccgtcgaaccagagcgtgcgcgatttc
gcattctgctcggccgccgacgaccgcgggctgttcggccagaaagcgtacctgcgccgc
gtgtcgagcgacgcgagcgaggccgcgccgcacgggcgctggatcggcctgctgaacgtg
cgcggcgcgggcgtcgcgcggctgaaggcgatgctcggtacgctccaggcgcgcgacgat
ttcgatgcgctcgacctgccggcgctgctgaacgcgctcgtcgacgcgggcgagcagatc
gaagtgcagtacgtgcacggccattggcgcggcgtcaacgatctcgacgacttccgccgc
gcgggcgacttcgcgcacggccagacgccgtacgcggagcagaacgcgggcagcgggagc
gcacgatga

DBGET integrated database retrieval system