KEGG   Burkholderia mallei ATCC 23344: BMAA1794Help
Entry
BMAA1794          CDS       T00204                                 

Gene name
acs
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bma01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bma00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bma00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bma00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bma00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
2:complement(1961948..1963930)
Genome map
AA seq 660 aa AA seqDB search
MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAERDYEGFWARLARETLEWRKP
FGKVLDETNAPFYKWFEDGELNASYNCLDRHVAAGLGERVAVIFEADDGTVTRVTYADLL
ARVSRFANALKKRGVGRGDRVVIYIPMSVEGIVAMQACARIGATHSVVFGGFSSKSLHER
IVDVGATALVTADEQMRGGKTLPLKSIADEALAMGGCDAVKTVVVYRRTGGNVDWHAGRD
VWMHEMVANESDACEPEWVGAEHPLFILYTSGSTGKPKGVQHSTAGYLLWVAQTMKWTFD
WKPDDVFWCTADIGWVTGHSYITYGPLAVGATQVVFEGVPTYPNAGRFWKMIGDHKVTVF
YTAPTAIRSLIKAAEADDRVHPRSYDLSSLRIIGTVGEPINPEAWIWYHKNVGQARCPIV
DTWWQTETGGHMITPLPGATPTVPGSCTLPLPGIMAAVVDETGQDVPNGQGGILVVKRPW
PAMARTIWGDPERFKKSYFPEELGGRLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRL
GTMEIESALVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEGEEAAALAKTLRDWVG
KEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILEQLAEVR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgattgaatcggttctgcacgaacgccgccagttcgcgccgcccgccgccgtg
gagaaggcggcagccatttccgggatggcggcttatcgggcgctcgccgaagaggctgag
cgcgattacgaaggattctgggcgcgtctcgcgcgcgagacgctcgaatggcgcaagccg
ttcggcaaggtgctcgacgagacgaacgcgccgttctacaagtggttcgaggacggcgag
ctgaacgcgtcgtacaactgcctcgaccgccacgtcgccgcgggcttgggcgagcgcgtc
gcggtgatcttcgaggccgacgacggcaccgtcacgcgcgtcacctacgccgatctgctc
gcgcgcgtgtcgcgcttcgcgaacgcgctgaagaagcgcggcgtcggccgcggcgaccgc
gtcgtcatctacattccgatgtcggtcgaaggcatcgtcgcgatgcaggcgtgcgcgcgg
atcggcgcgacgcactcggtggtgttcggcggcttctcgtcgaagtcgctgcacgagcgc
atcgtcgacgtcggcgcgaccgcgctcgtcaccgccgacgagcagatgcgcggcggcaag
acgctgccgctcaagagcatcgccgacgaggcgctcgcgatgggcggctgcgacgcggtg
aagaccgtcgtcgtgtatcgccgcacgggcggcaatgtcgactggcacgcgggccgcgac
gtctggatgcacgagatggtcgcgaacgagtccgacgcgtgcgagcccgaatgggtcggc
gccgagcatccgctgttcatcctgtacacgtccggctcgaccggcaagccgaagggcgtc
cagcacagcacggccggctatctgctatgggtcgcgcagacgatgaagtggacgttcgac
tggaagcccgacgacgtgttctggtgcacggccgacatcggctgggtcacgggccactcg
tatatcacgtatgggccgctcgccgtcggcgcgacgcaggtggtgttcgagggcgtgccg
acctatccgaacgcgggccgcttctggaagatgatcggcgaccacaaggtcaccgtgttc
tacaccgcgccgaccgcgatccgctcgctgatcaaggcggccgaggccgacgaccgcgtg
catccgaggagctacgatctgtcgagcctgcggatcatcggcacggtcggcgagccgatc
aatccggaagcgtggatctggtatcacaagaacgtcgggcaggcgcgctgcccgatcgtc
gacacctggtggcagaccgaaacgggcggccacatgatcacgccgctaccgggcgcgacg
ccgacggtgccgggctcgtgcacgctgccgctgccgggcatcatggccgcggtcgtcgac
gagacgggccaggacgtgccgaacgggcagggcggcattctcgtcgtcaagcgcccgtgg
ccggcgatggcgcgcacgatctggggcgacccggagcgcttcaagaagagctatttcccc
gaggagctcggcggccgcctgtatctggcgggcgacggcaccgtgcgggacaaggaaacc
ggctacttcacgatcatgggccgcatcgacgacgtgctgaacgtatcggggcaccggctc
ggcacgatggagatcgaatcggcgctcgtgtcgcacgagctcgtcgccgaggcggccgtc
gtcggacggccggacgacacgacgggcgaggcggtcgtcgcgttcgtcgtgctcaagcgc
tcgcggccggaaggcgaggaggcggccgcgctcgcgaagacgctgcgcgactgggtcggc
aaggagatcgggccgatcgcgaagccgaaggacatccgtttcggcgataacctgccgaag
acgcgttcgggcaagatcatgcggcgcctgctgcgctcgctcgcgaagggcgaggcgatc
acgcaggatacgtcgacgctcgagaaccccgcgattctcgaacagctcgccgaagtgcgc
tga

DBGET integrated database retrieval system