KEGG   Burkholderia mallei ATCC 23344: BMAA1958Help
Entry
BMAA1958          CDS       T00204                                 

Definition
(RefSeq) dihydroflavonol-4-reductase family protein
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bma  Burkholderia mallei ATCC 23344
Brite
Enzymes [BR:bma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     BMAA1958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NmrA NAD_binding_4 Polysacc_synt_2 adh_short RmlD_sub_bind PALP DFP
Motif
Other DBs
NCBI-GeneID: 3086512
NCBI-ProteinID: YP_106481
UniProt: A0A0H2W9Z1
Position
2:2147074..2148081
Genome map
AA seq 335 aa AA seqDB search
MTDIQRDLVLVTGASGFVGSAVARAARRRGYRVRVLVRLTSPRTNVADLDAEIATGDMRD
EASMRAALRGVRHLLHVAADYRLWAPDPLEIERANLEGAVATMRAALAEGVERIVYTSSV
ATLKVTPSGASADESSPLAAGQAIGVYKRSKVLAERAVERMIAEDGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAQGHLLALERGRVGERYILGGENL
PLQAMLADIAQSTGRKPPTIALPRWPLYPIALGAEAVAKLTKREPFVTVDGLRMSKNKMY
FTSAKAERELGYRARPYREGIRDALDWFRQAGYLR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactgacatacaacgcgatctcgttctggtgaccggcgcatccggttttgtcggctcc
gccgtcgcgcgcgccgcgcggcggcggggctatcgggtgcgcgtgctcgtgcggctgacg
agcccgcgcacgaacgtcgcggatctcgacgccgagatcgccaccggcgacatgcgcgac
gaggcatcgatgcgcgccgcgctgcgcggcgtgcgccatctgctgcacgtcgccgccgac
taccggctgtgggcgcccgatccgctcgagatcgagcgcgcgaatctcgaaggcgcggtc
gcgacgatgcgcgcggcgctcgccgagggcgtcgagcggatcgtctacacgagcagcgtc
gccacgctgaaggtgacgccgtcgggcgcctcggccgacgaatcgtcgccgctcgccgcc
gggcaggcgatcggcgtatacaagcgcagcaaggtgctcgccgagcgcgcggtcgagcgg
atgatcgccgaggacgggctgcccgcggtgatcgtcaatccgtcgacgccgatcggcccg
cgcgacgtgaagccgacgccgaccggccggatcatcgtcgaggcggcgctcggcaagatc
ccggcgttcgtcgacacggggctgaacctcgtgcacgtcgacgacgtcgcgcagggccac
ctgctcgcgctcgagcgcgggcgcgtcggcgagcgctacatcctcggcggcgagaacctg
ccgctgcaggcgatgctcgccgacatcgcgcaatcgacgggacgcaagccgccgacgatc
gcgctgccgcgctggccgctgtatccgatcgcgctcggcgcggaggcggtggcgaagctg
acgaagcgcgagccgttcgtgacggtcgacgggctcaggatgtcgaagaacaagatgtat
ttcacgtccgcgaaagccgagcgcgagctcggctaccgcgcgcggccgtaccgcgaaggc
attcgcgacgcgctcgactggttcaggcaggcgggctatctgcgctga

DBGET integrated database retrieval system