KEGG   Burkholderia mallei ATCC 23344: BMAA2022Help
Entry
BMAA2022          CDS       T00204                                 

Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bma  Burkholderia mallei ATCC 23344
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    BMAA2022
Enzymes [BR:bma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     BMAA2022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
2:2209220..2210878
Genome map
AA seq 552 aa AA seqDB search
MKQQSYDYDYVVVGSGFGGSVSALRLSEKGYRVLVIEQGRRWTPENLPESTWNLSRWQWR
PALGLHGFFSMRFFRHVVVLHGNAVGGGSITYANTLLVPPNKVWREGTWAGLEDWERVMP
AHYATAKRMLGVVTNRRMDAADFRLKDMAKLIGVEKSFYPTEVGVFFGDDADAPGTRYAD
PYFGGAGPERTSCIGCGGCMVGCRHGAKNTLDRNYLYLAERLGAQVREQTKVVDVRPLDA
RADGAAGYAVEAVSLAAGARGAKSRLTCRGVVFAASSLGTQDLLMRLKEKGSLPRLSDAL
GKRVRTNAESLIGVRFPKSRVDLSKGVAIGSGIYIDEHTHIEATRYPSGSDTMGLLTTVL
TRGAPGGLRVLVWLGALAKLVLTRPLSAWRMIDPRGFARETMIFLCMQTLEGHLTMRLKR
RWFWPFSKQLATSGAKIPAYIPAANDFAQKAARALGGVPMTSLTEILLNVPMTAHCMGGA
AMARDARDGVCDGRSRVFGYRNMYVCDGSVLGANLGVNPSLTITALAEHAMSHVPAAREQ
RWDSTAETPVAA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcagtcctacgattacgactacgtcgtggtcggctccggcttcggcggcagc
gtctcggcgctgcgtctgtccgagaaaggctatcgtgtgctcgtgatcgagcagggccgt
cgctggacgcccgagaacctgccggaaagcacgtggaacctgtcgcgctggcaatggcgc
cccgcgctcgggctgcacggcttcttcagcatgcgctttttcaggcacgtcgtcgtgctg
cacggcaatgcggtgggcggcggctcgatcacgtacgcgaacacgctgctcgtgccgccc
aacaaggtctggcgcgagggcacatgggccggcctcgaggactgggaacgcgtgatgccc
gcgcactacgccaccgcgaagcgcatgctcggcgtcgtcacgaaccggcgaatggatgcg
gccgacttccggctgaaggacatggcgaagctgatcggcgtcgagaagagcttctatccg
accgaggtcggcgtgttcttcggcgacgacgccgacgcgcccggcacgcgctacgccgat
ccgtacttcggcggcgcgggcccggagcgcacgtcgtgcatcggctgcggcggctgcatg
gtcggctgccgccacggcgcgaagaacacgctcgaccgcaattacctgtatctcgccgag
cgcctcggcgcgcaggtgcgcgagcagacgaaggtcgtcgacgtgcgcccgctcgacgcg
cgcgccgacggcgcggcgggctacgcggtcgaagcggtgtcgctcgcggcgggcgcgcgc
ggcgcgaaaagccgcctcacgtgccgcggcgtcgtgttcgccgcatcctcgctcggcacg
caggatctgctgatgcgcctgaaggaaaagggctcgctgccccggctatcggacgcgctc
ggcaagcgcgtgcgcacgaacgccgaatcgctgatcggcgtgcgctttccgaaatcgcgc
gtcgatctgtcgaagggcgtggcgatcggctcgggcatctacatcgacgagcacacgcac
atcgaggccacccgctatccttcgggctccgacacgatggggctgctcacgaccgtgctc
acgcgcggcgcgccgggcggtttgcgtgtgctcgtgtggctcggcgcgctcgcgaagctc
gttctcacgcgaccgctgagcgcgtggcggatgatcgacccgcgcggcttcgcgcgcgag
acgatgatcttcctctgcatgcagacgctcgaaggacacctgacgatgcgcctgaagcgc
cgctggttctggccgttctcgaagcagctcgcgacctccggcgcgaagatccccgcctac
attccggccgcgaacgacttcgcgcagaaggccgcgcgcgcgctcggcggcgtgccgatg
acctcgctcaccgagatcctgctgaacgtgccgatgaccgcgcattgcatgggcggcgcg
gcgatggcgcgcgacgcgcgcgacggcgtgtgcgacggccgcagccgcgtgttcggctat
cggaacatgtacgtctgcgacggctcggtgctcggcgcgaacctcggcgtcaacccgagc
ctcacgatcacggcgctcgccgagcatgcgatgagccacgtgcccgccgcgcgcgagcag
cggtgggacagtaccgcggagacgcctgtcgcggcatga

DBGET integrated database retrieval system