KEGG   Burkholderia mallei 092700E: BM44_4071Help
Entry
BM44_4071         CDS       T03524                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase family protein
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bmaz  Burkholderia mallei 092700E
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bmaz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BM44_4071
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BM44_4071
Enzymes [BR:bmaz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BM44_4071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(1109276..1110061)
Genome map
AA seq 261 aa AA seqDB search
MSDILDKIIAVKREEIAAALESAPLEELKVQASARDSRDFVGALRDKHAAGHAAVIAEVK
KASPSKGVLREHFVPADIARSYAQHGAACLSVLTDERFFQGSARYLEQARAACTLPVLRK
DFIVDAYQLLEARAMGADAILLIAAALDTPLMIDLEAYAHSLGLAVLVEVHNRGELDEAL
KLKTPFVGINNRNLRTFETTIDTTLGMLDAIPDDRIVVTESGILSRADVERMEAAGVHTF
LVGEAFMRAENPGAELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcgacaaaatcatcgccgtcaagcgcgaagagatcgccgccgcgctc
gagagcgcgccgctcgaagaactgaaggtgcaggcgtcggcgcgcgattcgcgcgacttc
gtcggcgcgctgcgcgacaagcacgcggccggacacgccgccgtcatcgccgaggtgaag
aaggcgagcccgtcgaaaggcgtgctgcgcgagcatttcgtgccggccgacatcgcccgc
tcgtacgcgcagcacggcgccgcatgcctgtcggtgctgaccgacgagcggttcttccag
ggcagcgcgcgctatctcgaacaggcgcgcgccgcgtgcaccctgcccgtgctgcgcaag
gacttcatcgtcgacgcgtaccagctgctcgaagcgcgcgcgatgggcgcggacgcgatc
ctgctgatcgccgcggcgctcgacacgccgctgatgatcgatctcgaggcgtacgcgcat
tcgctcgggctcgcggtgctcgtcgaagtgcacaaccgcggcgaactggacgaagcgttg
aaactgaagacgccgttcgtcggcatcaacaaccgcaacctgcgtacattcgagacgacg
atcgacacgacgctcggcatgctcgacgcgattccggacgatcggatcgtcgtcaccgaa
tccggcatcctgtcgcgcgcggacgtcgagcggatggaggcggcgggcgtgcatacgttc
ctcgtcggcgaagcgttcatgcgcgccgagaacccgggcgcggaactcgcgcggatgttc
ttctga

DBGET integrated database retrieval system