KEGG   Brucella abortus 9-941: BruAb1_0039Help
Entry
BruAb1_0039       CDS       T00241                                 

Definition
cytochrome c, membrane-bound
Orthology
K08738  
cytochrome c
Organism
bmb  Brucella abortus 9-941
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BruAb1_0039
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BruAb1_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:44157..44765
Genome map
AA seq 202 aa AA seqDB search
MNSTRNNKFIMAFLATVFVVMTTGILSDSLFHSPAPEKPGFAIEVAQGSGGGESAAAPAK
KEVSIATLLQSADPARGEVVFKRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSA
AMKEFGAAGNKWDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSDNPVP
LPAADAAPADSDKKPAEAAPAN
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaacccggaataacaaatttattatggcatttctggcaacggttttcgttgtc
atgacgacgggcattctgtctgattcgctgtttcattcgccggctcctgaaaagccgggc
tttgccatagaggtagcccaaggttcggggggcggagaaagtgctgcggctcccgccaag
aaagaagtttcaattgcaaccctgttgcaaagtgccgatccggcgcgtggcgaagtggtt
ttcaagcgttgccaggcttgccacaccggggacaagggcggggccaacaaggttggtccg
catctgtggggtgtcgtgggtcgcccggctgcctccgttgaaggtttcagctattccgct
gccatgaaggaattcggcgcggctggcaacaagtgggattttgagcatctcaacaagttc
ctcacctcgccgaaaggcttcatcaagggtacagccatgggctttgccggtgacaagaag
gataatgagcgcgctgacctgattgcttatctgcgcacgctgtccgacaatccggtgccg
ctgccggccgcagacgcagcgcccgcagatagcgataaaaagcccgccgaagctgcaccg
gccaattga

DBGET integrated database retrieval system