KEGG   Brucella abortus 9-941: BruAb1_0418Help
Entry
BruAb1_0418       CDS       T00241                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bmb  Brucella abortus 9-941
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BruAb1_0418 (ispE)
Enzymes [BR:bmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BruAb1_0418 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(420569..421468)
Genome map
AA seq 299 aa AA seqDB search
MTAFQNAGPSITRLAPAKINLALHVTGRRDDGYHLLDMLVVFADHGDRIHIEKAGSDSFT
VSGPFASGIPAGRGNLVLKARDALRQHGGPDLSPVAIHLEKNLPIASGIGGGSSDAAATL
LALNTLWQLDLDFEMLAAIGLSLGADLPMCLHGAAHGTPLIARGIGEELNDVSGIAALPM
LLVNDGTALATPDVFRALTRRENAPLPPPACEGTDALCAYLRETRNDLLPAAISLAPQIE
PKLALLRAKGALYAQMSGSGATCFAIFSDESALTRAAKEIADENPGWFAVPSHSFPSRA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacagcattccagaacgccggaccatcgataacgcgccttgcgcctgcaaagatcaat
ctggcgctgcatgtgaccgggcgacgtgacgacggctatcatcttctcgacatgctggtg
gtctttgccgatcacggcgatcgcatccacatcgaaaaagccggcagcgacagttttacg
gtcagcggcccttttgcaagcggcatccccgccgggcggggcaatctggtgctgaaagcg
cgcgatgcgctgcgccagcatggcgggccagacctttcacctgttgccattcatctggaa
aagaacctgcctattgcttccggcattggcggcggatcgagcgatgcggcagcaaccctg
cttgcgctcaacacgctctggcaactcgatctcgattttgaaatgctggccgctatcggc
ctttccctcggtgcagaccttcccatgtgcctgcatggcgcagcccatggcacaccgctg
atcgcgcgcggcattggtgaagagctgaacgatgtttccggaattgcggcccttcccatg
ctgctcgtcaatgacggtaccgcgcttgccacgcccgacgtgttccgcgcgctcacccgc
cgcgagaacgcccccctgccgcctccggcctgtgaagggacagacgccctttgcgcctat
ctgcgtgaaacacgcaatgatcttctgcccgcagccatcagccttgcaccgcagatcgaa
cccaaactcgccctgcttcgcgccaagggtgcactttatgcgcaaatgtccggctccggc
gcaacatgctttgccatttttagcgatgaatcagccctgacacgcgcggcaaaagagatt
gcggatgaaaatccgggctggtttgcagttccttcgcacagctttccttccagagcctga

DBGET integrated database retrieval system