KEGG   Brucella abortus bv. 1 9-941: BruAb1_0506Help
Entry
BruAb1_0506       CDS       T00241                                 

Gene name
thrC
Definition
(GenBank) ThrC, threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bmb  Brucella abortus bv. 1 9-941
Pathway
bmb00260  Glycine, serine and threonine metabolism
bmb00750  Vitamin B6 metabolism
bmb01100  Metabolic pathways
bmb01110  Biosynthesis of secondary metabolites
bmb01120  Microbial metabolism in diverse environments
bmb01230  Biosynthesis of amino acids
Module
bmb_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BruAb1_0506 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BruAb1_0506 (thrC)
Enzymes [BR:bmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BruAb1_0506 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AAX73897
UniProt: Q57EN7
Position
I:complement(504606..505997)
Genome map
AA seq 463 aa AA seqDB search
MKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQEYPQFTAEQIRALRGKSYVEVALAVLT
PFTGGEIPAADFERMVREAYGTFRHDAVCPLVQTDANEFVLELFHGPTLAFKDVAMQLLA
RMMDYVLAQRGERATIVGATSGDTGGAAIEAFGGRDNTDIFILFPNGRVSPVQQRQMTSS
GFSNVHALSIEGNFDDCQNLVKGMFNDLEFCDALSLSGVNSINWARIMPQVVYYFTAALS
LGAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIEQLIIATNDNDILSRTLESGAYEMRGV
AQTTSPSMDIQISSNFERLLFEAHGRDAAAVRGLMQGLKQSGGFTISEKPLSAIRSEFSA
GRSTVDETAATIESVLSKDGYLLDPHSAIGVKVAREKASGTAPMVVLATAHPAKFPDAVK
AACGVEPQLPAWLCDLMQRKESFTVLHNELKIVEEYVRHHSRA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgtaagtacgcgtggggaagcaccggttctgggattcagcgatgcattgctc
gcaggcctcgcccgtgatggcggtctttatctgccgcaggaatatccgcaattcacagcc
gaacagatccgcgccctgcgtggaaaatcctatgtcgaagtcgcgctggccgtcctcacg
ccctttaccggcggtgaaattccggcagccgatttcgagcgcatggtccgcgaagcttac
ggaaccttccgtcacgatgccgtctgcccgttggtgcagaccgacgcgaacgaattcgtg
ctggagcttttccatggccccacccttgccttcaaggatgtcgccatgcagcttctggcc
cgcatgatggattatgttctggcacagcgcggcgagcgcgcaacgatcgtcggcgctaca
tccggcgatacgggcggcgcagccatcgaagcctttggcgggcgcgacaacacagacatt
ttcatcctgttccccaatgggcgggtctcgccggtacagcaacgccagatgacgtcttcc
ggcttttccaatgtccatgcgctttccatcgagggcaatttcgacgattgccagaacctc
gtaaaaggcatgttcaatgatctggaattctgtgacgccctgtcgctttccggcgtgaac
tcgatcaactgggcgcgcatcatgccgcaggttgtctattatttcacggcagcactcagc
ctcggcgcaccggaccgcgccgtgtccttcacggtgcccaccggcaatttcggcgatatt
ttcgcaggctacgtcgccaagcgcatgggcctgcccatcgagcaactcatcatcgccacc
aacgacaacgatattctttcgcgcacgctggaaagcggggcctatgagatgcgcggcgta
gcgcagaccacttcgccctcaatggatatccagatttcctccaatttcgagcggcttctg
ttcgaggcacacgggcgcgatgcggcggccgtgcgcgggctgatgcagggcctgaagcaa
tctggcggatttacgatttccgaaaagccgctttcggccatccgcagcgaattttcggct
ggccgctccaccgtcgatgagacggcggcgactatcgaatcggttctttccaaagacggc
tatctgcttgatccgcattcggcgatcggtgtgaaggtcgcgcgtgaaaaagcatccggc
accgccccgatggtggttctggcgaccgcccatccggccaaattcccggatgcggtgaag
gctgcatgtggggtcgagccgcaattgccggcatggctttgcgacctgatgcaacgaaaa
gaaagcttcacagttcttcacaacgagctgaaaatcgtggaagaatatgtgcgccaccat
tcccgagcctga

DBGET integrated database retrieval system