KEGG   Brucella abortus bv. 1 9-941: BruAb1_0709Help
Entry
BruAb1_0709       CDS       T00241                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bmb  Brucella abortus bv. 1 9-941
Pathway
bmb00230  Purine metabolism
bmb00240  Pyrimidine metabolism
bmb01100  Metabolic pathways
bmb03030  DNA replication
bmb03430  Mismatch repair
bmb03440  Homologous recombination
Module
bmb_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BruAb1_0709
   00240 Pyrimidine metabolism
    BruAb1_0709
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BruAb1_0709
   03430 Mismatch repair
    BruAb1_0709
   03440 Homologous recombination
    BruAb1_0709
Enzymes [BR:bmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BruAb1_0709
DNA replication proteins [BR:bmb03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BruAb1_0709
DNA repair and recombination proteins [BR:bmb03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     BruAb1_0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AAX74084
UniProt: Q57E50
Position
I:700009..700458
Genome map
AA seq 149 aa AA seqDB search
MAEILFYHLTESTLDEALPGLVERSLGRGWRVTVQTVSEERRDALDSLLWTFSDTSFVAH
GTDKEPNPEHQPVLLTTTETNPNGATVRFLVEGAKLEQAGDYERLVVMFDGHDQDQLDIA
RTQWKAFKAENHDLTYWQQTPDRRWERKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatacttttttaccatctgacggaatcgacactggatgaagccctgccgggc
cttgtcgaacgctcgttggggcgtggttggcgcgtaacggttcaaaccgtcagtgaagag
cggcgcgatgcgctggacagcctgctctggaccttttcggacacgtcttttgtggcgcat
ggcacggataaggaacccaatcctgaacatcagcccgtattgttgaccacgactgaaacc
aatcccaacggtgcaacggtccgctttcttgtggaaggcgcgaagctggaacaggccgga
gattatgagcggcttgtggtgatgttcgacgggcatgatcaggatcagctcgacattgcc
cgcacccaatggaaagccttcaaggcggagaaccatgatttgacctattggcagcagacg
cctgaccggcgctgggagcgtaaagcctga

DBGET integrated database retrieval system