KEGG   Brucella abortus 9-941: BruAb1_0709Help
Entry
BruAb1_0709       CDS       T00241                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bmb  Brucella abortus 9-941
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bmb00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bmb00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:bmb03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bmb03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bmb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:700009..700458
Genome map
AA seq 149 aa AA seqDB search
MAEILFYHLTESTLDEALPGLVERSLGRGWRVTVQTVSEERRDALDSLLWTFSDTSFVAH
GTDKEPNPEHQPVLLTTTETNPNGATVRFLVEGAKLEQAGDYERLVVMFDGHDQDQLDIA
RTQWKAFKAENHDLTYWQQTPDRRWERKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatacttttttaccatctgacggaatcgacactggatgaagccctgccgggc
cttgtcgaacgctcgttggggcgtggttggcgcgtaacggttcaaaccgtcagtgaagag
cggcgcgatgcgctggacagcctgctctggaccttttcggacacgtcttttgtggcgcat
ggcacggataaggaacccaatcctgaacatcagcccgtattgttgaccacgactgaaacc
aatcccaacggtgcaacggtccgctttcttgtggaaggcgcgaagctggaacaggccgga
gattatgagcggcttgtggtgatgttcgacgggcatgatcaggatcagctcgacattgcc
cgcacccaatggaaagccttcaaggcggagaaccatgatttgacctattggcagcagacg
cctgaccggcgctgggagcgtaaagcctga

DBGET integrated database retrieval system