KEGG   Brucella abortus 9-941: BruAb1_0709Help
Entry
BruAb1_0709       CDS       T00241                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bmb  Brucella abortus 9-941
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BruAb1_0709
   00240 Pyrimidine metabolism
    BruAb1_0709
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BruAb1_0709
   03430 Mismatch repair
    BruAb1_0709
   03440 Homologous recombination
    BruAb1_0709
Enzymes [BR:bmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BruAb1_0709
DNA replication proteins [BR:bmb03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BruAb1_0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:700009..700458
Genome map
AA seq 149 aa AA seqDB search
MAEILFYHLTESTLDEALPGLVERSLGRGWRVTVQTVSEERRDALDSLLWTFSDTSFVAH
GTDKEPNPEHQPVLLTTTETNPNGATVRFLVEGAKLEQAGDYERLVVMFDGHDQDQLDIA
RTQWKAFKAENHDLTYWQQTPDRRWERKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatacttttttaccatctgacggaatcgacactggatgaagccctgccgggc
cttgtcgaacgctcgttggggcgtggttggcgcgtaacggttcaaaccgtcagtgaagag
cggcgcgatgcgctggacagcctgctctggaccttttcggacacgtcttttgtggcgcat
ggcacggataaggaacccaatcctgaacatcagcccgtattgttgaccacgactgaaacc
aatcccaacggtgcaacggtccgctttcttgtggaaggcgcgaagctggaacaggccgga
gattatgagcggcttgtggtgatgttcgacgggcatgatcaggatcagctcgacattgcc
cgcacccaatggaaagccttcaaggcggagaaccatgatttgacctattggcagcagacg
cctgaccggcgctgggagcgtaaagcctga

DBGET integrated database retrieval system