KEGG   Brucella abortus 9-941: BruAb1_0869Help
Entry
BruAb1_0869       CDS       T00241                                 

Gene name
galM
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bmb  Brucella abortus 9-941
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmb00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bmb00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:852681..853703
Genome map
AA seq 340 aa AA seqDB search
MNSEIFGYAPDGQVVHRLTISNGPLTAKIINWGAAIQDLRMEGHPAPLVIGYRDFADYPA
HSPHLGAIAGRSANRIRNARFDLDGTVYEVEPNFLGRHNLHGGSKGLGHHVWKITATGPD
FVSLATVSPDGEMGFPGNLNVNCTYMLNADGTLIVRLEAVTDRPTICNLLHHSYFNLDDG
GEGDVLDHQFKIAGDAYLPVDEALIPDGRVLPVKDTAFDFREFRPLRMQENGRQVAYDNN
FCLAAARGPLRPCASVKAARSGIRLDISTTEPGIQLYAGNTMANDCIGLTGKPYGKHAGF
CLEPQIWPGALEYPYFPQPILRPGDIYAQTSHFTFSREED
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcggaaatcttcggctatgcgccggacgggcaggtggtccaccgcctcactatc
tccaacgggcctttgaccgcaaagatcatcaattggggcgcagccattcaggatctgcgt
atggaaggccacccggcgccactggtgatcggctatcgcgattttgccgattatccggca
cattccccgcatctgggtgcgattgcgggccgctcggccaaccgtatccgcaatgcgcgc
tttgatcttgatggaacggtttacgaggtggagccgaacttccttggccgccacaatctg
catggcggcagcaaggggctcggacaccatgtctggaagatcacggcgaccggccctgat
ttcgtgtcgcttgcaacggtttctcccgatggcgagatgggcttccccggcaatctgaat
gtgaattgcacctatatgctcaatgcggatggaacgctgattgttcggctggaggctgtg
accgataggccaaccatatgcaatctgcttcaccacagctatttcaatctggatgacggt
ggtgagggtgatgttctcgaccaccaattcaagattgcaggcgacgcctatcttccggtg
gatgaggcgcttattccggacgggcgggttctgccggtaaaggacacggctttcgatttc
cgcgaattcaggccgcttcgtatgcaggaaaacggccgtcaggtggcgtatgacaataat
ttctgccttgcggctgcacgcggcccgctgcgcccctgcgcttcggtaaaggccgcgcgg
tccggcatccggcttgatatttcaactaccgaaccggggatacagctctatgctggcaac
accatggccaatgattgcataggactgacgggcaagccctatggcaaacatgctggcttt
tgccttgaaccacagatatggccgggcgcgctggaatatccttattttccgcagccgatc
ctgcgcccgggcgatatttacgcacagaccagccattttaccttttcgcgcgaggaggat
taa

DBGET integrated database retrieval system