KEGG   Brucella abortus 9-941: BruAb1_0891Help
Entry
BruAb1_0891       CDS       T00241                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bmb  Brucella abortus 9-941
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BruAb1_0891
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BruAb1_0891
Enzymes [BR:bmb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BruAb1_0891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:874796..875815
Genome map
AA seq 339 aa AA seqDB search
MKECKAWIAGISGTKLTPDEIAFFRDETPWGFILFARNVESLEQVSELTAHLRDLTGLDQ
TPVFIDQEGGRVQRLRPPLVPNYPSASEIGAIYARDKEKGLRAAWLHARLHAFDLLKVGV
NADCLPVLDVPVEGAHDVIGMRAYSKNPHAVAEMGRAAAEGLLAGGVLPVVKHMPGHGRA
FSDTHKELARVSVALNELVAHDFVPFKALNDLPMAMSAHVVFDCIDPERPSTLSPTVINT
IIRDVIGFDGLVISDDISMKALSGDLGDITDGIVTAGSDIVLYCSGVMEELVKVAARVPV
LDGKAKRRAELAEVYAGDPDLSDEDEVRAEFNAMFEPIA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagtgcaaggcatggattgccggtatatccggcacgaagctcaccccggacgag
attgccttcttccgggatgaaaccccgtggggcttcattctttttgctcgcaatgtggaa
agcctcgaacaggtgagcgagctcaccgcccatctgcgtgacctgacggggctggaccag
acgccggttttcatcgatcaggagggcgggcgcgtgcagcgccttcgcccgccgctggta
ccgaactatccgtccgcgtccgaaattggcgcgatctatgcacgcgacaaggaaaagggg
ttgcgtgccgcctggctccatgcccggctccatgctttcgatctgttgaaggtcggcgtc
aatgcggattgcctgccggttctggatgtgccggtggagggcgcgcatgatgtgatcgga
atgcgggcctattccaaaaacccccatgcggttgcggaaatgggacgcgctgccgccgaa
ggtcttctggctggcggcgttcttcccgtcgtgaagcatatgccgggccatggccgcgcc
ttttccgatacgcataaggaactggcgcgggtcagcgttgcgctcaacgaactggttgcg
catgatttcgtgccgttcaaggcgctcaatgatctgccgatggccatgtccgcccatgtg
gtgttcgattgcatcgacccggaaagaccgtccacgctttcgccgacggttattaatacg
atcattcgcgatgtgatcgggttcgacggccttgtcatcagtgacgacatttccatgaag
gcattgtccggcgatcttggcgatataaccgacggcatcgttacggcgggcagcgatatc
gtgctctattgctcaggcgttatggaggaactggtaaaggttgccgcccgtgtgccggtt
ctggatggcaaagcaaagcgccgggccgaactggcggaagtctatgcgggcgaccccgat
ctttccgacgaggacgaggtgcgcgccgaattcaatgccatgtttgaaccgatagcgtaa

DBGET integrated database retrieval system