KEGG   Brucella abortus 9-941: BruAb1_0899Help
Entry
BruAb1_0899       CDS       T00241                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bmb  Brucella abortus 9-941
Brite
Enzymes [BR:bmb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BruAb1_0899 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:881607..882275
Genome map
AA seq 222 aa AA seqDB search
MRQATSERPRLSDREGFASFVLRMRGHSIDDPQLFAAIEATPRQSFLAAAWSHLAYSPRT
APLDCGEYMEGIDDQARVISALKLEPGHRVLEIGTGSGFTAAVMSLLSGRVTTVERYRKL
CDHALQQFVSLKRENIMVKHTDGRHGMPGGPFDRIVIWLACDEVPRHFVELLATHSVLIA
PIGPGDGRQIMTRISKVGSRFEQEDLMPVRYQPFIEGTSSVL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaggcaacgtctgaacgcccgcggctttcggaccgggagggatttgcatccttt
gttctgcggatgcgtgggcacagcattgatgatccgcaactttttgcggcaattgaagca
acgccgcgccagagctttctggcggcggcatggtcgcatcttgcctatagcccgcgaacc
gcgccgcttgattgcggtgaatatatggaaggcatagacgatcaggcgcgcgtcatttcc
gccctgaagcttgagcccggccatcgggttctggaaatcggcaccggctccggctttacc
gccgccgttatgtccttgctgtccggccgtgtaacgacggtggaacggtatcgaaaactc
tgcgaccacgctctccagcagttcgtttcgctgaagcgcgagaatatcatggtgaaacat
acagacgggcgccacggtatgccgggcgggccgtttgaccgcattgtcatctggctcgca
tgcgatgaggtgccgcgccatttcgttgaactgctcgccacccatagcgtcctgatagcc
ccgatcggccctggcgatggacgccagatcatgacgcggatttcaaaggttggaagccgt
tttgaacaggaagacctcatgccggttcgatatcagccgttcatcgaaggcacgtcttcc
gttctttag

DBGET integrated database retrieval system