KEGG   Brucella abortus 9-941: BruAb1_1034Help
Entry
BruAb1_1034       CDS       T00241                                 

Gene name
folP
Definition
dihydropteroate synthase FolP
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bmb  Brucella abortus 9-941
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1014702..1015541
Genome map
AA seq 279 aa AA seqDB search
MTKEWQLAHERSLHLGKTAIIMGVLNVTPDSFSDGGRYNDLDRAIAAAETMLEEGATIVD
VGGESTRPGATAVDAQTEASRVVPVIRELVRRFDCIISVDTYRASTARLAVEAGAHIVND
VWGLQREPEIAQLARETGAGLVIMHTSRDRLTNPDVIEDQFMFLNRSLKIAGDAGIEPSR
IVLDPGFGFGKERDEDIALMARMSELQAFGFPLLVGTSRKRFVGAMTGQADPRNRDIGTA
ATSVALRLAGADIFRVHNVAFNRDALAVADAILQSNVRI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagaatggcagcttgcccatgaacgcagcctccatctcggaaaaaccgccatc
attatgggagtactgaacgttacgccggattctttctcggatggcgggcgttataacgat
cttgatcgtgccatcgccgctgccgaaacgatgctggaggaaggcgcgaccattgtggac
gttgggggcgaatcgacgcgaccgggcgctactgctgtggatgcgcagacagaagccagc
cgtgtggttccggtaatccgggaactggtgaggcgcttcgattgtatcatttccgtggac
acttatcgtgcttctaccgcgcggcttgcggtggaggccggcgcgcatatcgtcaatgat
gtctgggggcttcagcgcgaaccggaaattgcccagcttgccagagaaacgggggcaggg
cttgtcatcatgcatacgagccgcgaccgcctcacgaatcccgacgtgatcgaagatcag
tttatgttcctgaacaggtcgctgaaaattgccggggatgcaggcatcgagccatcgcgc
atcgtgcttgatccgggtttcggcttcggcaaggagcgggatgaagacattgcgttgatg
gcgcgtatgtctgaattgcaggccttcggattccccctgctggtcggtacatcgcgcaag
cggttcgttggcgcaatgacggggcaggccgatccgcggaaccgcgatatcggcacagcg
gctacttccgtggcccttcgcctggcgggagccgacatcttccgtgttcacaatgtcgct
tttaacagagatgcacttgcagttgcggatgctatcctgcaaagcaacgtcaggatctaa

DBGET integrated database retrieval system