KEGG   Brucella abortus 9-941: BruAb1_1036Help
Entry
BruAb1_1036       CDS       T00241                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bmb  Brucella abortus 9-941
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1015916..1016449
Genome map
AA seq 177 aa AA seqDB search
MSTPPKPLRAWLGLGGNIDDPIISMASALRMLDGRSDTRVVSVSPVYRTPPWGKTDQAWF
HNACAQIETALQPLELIAACLDVERSLKRVRLERWGPRIIDIDILVMQDETGRAITMQEP
ALELPHPRMHERAFVLVPLNDIAPSLPVGARTVAEWAADCDRAEMEKARTDAGWWLE
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactccgccgaaaccattgcgcgcctggcttggcctcggcggcaatatcgatgat
ccgatcatctccatggcgagcgcgcttcgtatgctggatggacggagcgacacgagggtt
gtttccgtatccccggtctaccggaccccgccatggggcaagacggatcaggcctggttc
cacaatgcctgcgcgcaaatcgaaacggccttgcagccactggaactgattgcggcctgt
ctggacgtggagcgatccttgaaacgtgtgcggctggaacggtggggaccacgcatcatc
gatatcgatattcttgttatgcaggatgagacgggcagggcaatcacgatgcaggaaccg
gcattggagcttccgcatccacgtatgcacgagcgagccttcgttctggtgccgctcaat
gatatcgcaccttcgctgcctgtcggcgcgagaactgttgctgaatgggctgccgattgc
gaccgtgcggaaatggaaaaagcccgcacggatgcgggctggtggttggaatag

DBGET integrated database retrieval system