KEGG   Brucella abortus 9-941: BruAb1_1080Help
Entry
BruAb1_1080       CDS       T00241                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bmb  Brucella abortus 9-941
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1062804..1063445
Genome map
AA seq 213 aa AA seqDB search
MDARILQDNDDTSLPVNQASVTRIHKKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRV
AKAYQELFGGYSESPEEVLGTTFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYL
PEGRVVGLSKIARVVDIFARRLQTQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRS
IRKQGSSTITTTFTGDFKEKADQQVRFMTLIRT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggacgctcgcatcctccaagataacgacgacaccagcctgcctgtcaatcaggcatcc
gtaaccagaatacacaaaaagccaggcaaggccgaagcggaagctgccgttcgcaccctg
cttttgtgggccggcgaagaccccgatcgtgaaggcttgctggaaacgcccaagcgcgtc
gcaaaagcctatcaggaacttttcggcggctattcggaaagcccggaagaggttcttgga
accactttcgaggaagtcgcaggttacgacgatatggttctggtgaaggatatttccttc
ttctcccattgcgaacaccacatggtgccgatcatcggcaaggcgcacgtcgcctatctg
ccggaaggccgtgtcgtcggcctgtcgaagattgcgcgtgtcgtcgatatttttgcccgc
cgcctgcaaacgcaggaaagcatcacagcgcagattgccgacagcatccagcgcattttg
aagccacgcggcgtcgccgtcatgatcgaggcggaacatatgtgcatggccatgcgcagc
atccgcaagcagggttccagcacgatcaccaccacctttaccggcgatttcaaggaaaag
gcggaccagcaggttcgcttcatgaccctgatccgcacttga

DBGET integrated database retrieval system