KEGG   Brucella abortus 9-941: BruAb1_1189Help
Entry
BruAb1_1189       CDS       T00241                                 

Definition
7-cyano-7-deazaguanine reductase
Orthology
K09457  
7-cyano-7-deazaguanine reductase [EC:1.7.1.13]
Organism
bmb  Brucella abortus 9-941
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BruAb1_1189
Enzymes [BR:bmb01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.13  preQ1 synthase
     BruAb1_1189
Transfer RNA biogenesis [BR:bmb03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BruAb1_1189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1176329..1176796
Genome map
AA seq 155 aa AA seqDB search
MSENTIYSGLKQLGSHTDIPLTPEEAVLERVANPQEGTPYCVRFTAPEFSSLCPMTGQPD
FAHLVIDYVPGKWLVESKSLKLFLFSFRNHGAFHEDCTVTIGKRLVDLLEPEWLRIGGYW
YPRGGIPIDVFYQTGAAPLNVWIPEQGVANYRGRG
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaatacgatatattccggcctgaaacagctcggttcgcacacagatattccc
ctgacaccggaagaagcggttctggagcgcgtggcaaacccgcaagaaggcacgccctat
tgcgtgcgcttcaccgcgcccgaattcagctctctctgccccatgaccggtcagccggat
tttgcccatctggtgatcgactatgtgccgggcaaatggctggttgagagcaaatcgctg
aagctcttcctcttttccttccgcaaccacggcgcatttcacgaggattgcaccgtaacc
atcggcaaacgccttgtggacctgctggagccggaatggctgcggatcggaggctattgg
tatccgcgcggcggcattcccatcgatgttttctatcagaccggggcagcccccttgaat
gtctggatacccgaacagggcgtggccaactatcggggccgtggctag

DBGET integrated database retrieval system