KEGG   Brucella abortus 9-941: BruAb1_1189Help
Entry
BruAb1_1189       CDS       T00241                                 

Definition
7-cyano-7-deazaguanine reductase
Orthology
K09457  
7-cyano-7-deazaguanine reductase [EC:1.7.1.13]
Organism
bmb  Brucella abortus 9-941
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1176329..1176796
Genome map
AA seq 155 aa AA seqDB search
MSENTIYSGLKQLGSHTDIPLTPEEAVLERVANPQEGTPYCVRFTAPEFSSLCPMTGQPD
FAHLVIDYVPGKWLVESKSLKLFLFSFRNHGAFHEDCTVTIGKRLVDLLEPEWLRIGGYW
YPRGGIPIDVFYQTGAAPLNVWIPEQGVANYRGRG
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaatacgatatattccggcctgaaacagctcggttcgcacacagatattccc
ctgacaccggaagaagcggttctggagcgcgtggcaaacccgcaagaaggcacgccctat
tgcgtgcgcttcaccgcgcccgaattcagctctctctgccccatgaccggtcagccggat
tttgcccatctggtgatcgactatgtgccgggcaaatggctggttgagagcaaatcgctg
aagctcttcctcttttccttccgcaaccacggcgcatttcacgaggattgcaccgtaacc
atcggcaaacgccttgtggacctgctggagccggaatggctgcggatcggaggctattgg
tatccgcgcggcggcattcccatcgatgttttctatcagaccggggcagcccccttgaat
gtctggatacccgaacagggcgtggccaactatcggggccgtggctag

DBGET integrated database retrieval system