KEGG   Brucella abortus 9-941: BruAb1_1205Help
Entry
BruAb1_1205       CDS       T00241                                 

Gene name
phoA
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bmb  Brucella abortus 9-941
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BruAb1_1205 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BruAb1_1205 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BruAb1_1205 (phoA)
Enzymes [BR:bmb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BruAb1_1205 (phoA)
Exosome [BR:bmb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BruAb1_1205 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1193625..1195070
Genome map
AA seq 481 aa AA seqDB search
MPRKFTRPLLASAAIIVTFCAPASTVMAQSETAAPLFQRSAKGDLSAAGGARRLDGDITA
AFRDQIRKGPARNVILLIGDGMGDSEITVARNYAVGAGNHFKGIDALPVTGQYTHYSLDK
ESGKPNYVTDSAASGTAWTTGVKTYNGAIGVDIHGKPHKTLIELAKEKGLGTGNVSTAEL
QDATPAVQVAHVTHRKCYDPTSTAEKCKDNALENGGPGSISEQLLNTRPDVTLGGGAKYF
EDKARAGTWKGQTLSAQAEARGYQLVRNADALSKVETANQDKPVLGLFSPGNMPVRWKGP
QAAHHGNLDREPVKCKVNEKRTADIPTLAQMTEKAIDLLKTNEKGFFLQVEGASIDKQDH
AANPCGQIGETVDLDEAVQAALDFARKDGNTLVIVTADHAHASQIIDPDAKAPGLSQALK
TEDGAIMGVTYGNSDEADDQGHTGAQLRIAAFGPGAANFTGLTDQTDMFYTIRDALQLQA
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggaaattcacccggccacttctggcaagcgctgcaattattgtcaccttttgc
gcacccgcaagcaccgtgatggcccagtctgaaactgcggctccactcttccagcgcagc
gcaaaaggcgacctgtcggcagcaggcggcgcacgccgccttgatggtgatattaccgca
gcttttcgcgatcagatcaggaaggggcctgccagaaacgtcatcctgctgatcggagac
ggcatgggcgattccgagatcacggttgcgcgcaattatgcagtcggcgcaggcaatcat
ttcaagggcatcgatgcccttcccgttaccggccagtacacccattattcgctcgacaag
gaaagcggcaagccgaattacgtgactgattctgccgcctccggcaccgcctggaccact
ggcgtcaaaacctataacggcgccatcggcgtcgatattcatggcaaaccgcacaaaacg
ctcattgaactcgccaaggaaaagggcctcggcaccggcaatgtcagcactgccgaattg
caggatgccacacccgccgtgcaggttgcccatgttacccatcgcaagtgctacgaccca
accagcacggcggaaaagtgcaaggataatgcgcttgaaaatggcggcccaggctcgatc
agcgaacagcttttgaacacccgcccggacgtgacattgggcggcggcgcaaaatatttc
gaggacaaggcccgggctggcacatggaaaggccagaccttgagcgcacaggccgaagca
cgcggctatcaactggttagaaatgccgacgcattgagcaaggtcgagacagccaatcag
gacaaacctgttctcggcctcttctcaccgggcaacatgccggtccgctggaaagggcct
caggccgcccatcacggcaatctcgacagagagcctgtcaagtgcaaggtcaatgagaag
cgcactgccgatattccgacactggcgcaaatgaccgagaaagccatcgacctgctgaaa
accaacgaaaaaggctttttccttcaggtggaaggtgcctccatcgacaaacaggaccat
gccgccaatccgtgcgggcagatcggcgaaacagtcgatctggatgaagccgtgcaggcc
gcactcgattttgcccgcaaagacggcaacacgcttgtcatcgtaacggccgatcacgcc
catgcaagccagatcattgatcccgatgcgaaggccccgggtttgagccaggcattgaaa
accgaggatggcgcgatcatgggcgtgacctatggcaattccgacgaagccgacgatcag
ggccacacaggcgcgcaattgcgcatagccgcctttggccccggcgctgccaattttacc
ggcctcacggatcagacggatatgttctacacgatccgcgatgccttgcagttgcaggcg
gaataa

DBGET integrated database retrieval system