KEGG   Brucella abortus 9-941: BruAb1_1601Help
Entry
BruAb1_1601       CDS       T00241                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bmb  Brucella abortus 9-941
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BruAb1_1601 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BruAb1_1601 (aceA)
Enzymes [BR:bmb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BruAb1_1601 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:1579913..1581202
Genome map
AA seq 429 aa AA seqDB search
MTDFYSLIPSAPKGRFDGIERAHTAEDVKRLRGSVEIKYSLAEMGANRLWKLIHEEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELAKRINRT
LQRADQIETAEGKGLSVDTWFAPIVADAEAGFGGPLDAFEIMKAYIEAGAAGVHFEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGTPTLIVARTDAEAAKLLTSDIDERDQ
PFVDYEAGRTAEGFYQVKNGIEPCIARAIAYAPYCDLIWMETSKPDLAQARRFAEAVHKA
HPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNYGMFELARG
YKDRQMAAYSELQQAEFAAEADGYTATKHQREVGTGYFDAVSLAITGGQSSTTAMKESTE
TAQFKPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttttacagcctcatcccttcggcacccaagggccgcttcgacggcattgaa
cgtgcgcatacggccgaagacgtgaaaaggctgcgcggttcggtggagataaagtattcg
ctggccgaaatgggtgcaaaccgcctctggaagctgatccacgaggaagatttcgtcaat
gcgctgggcgcgctttccggcaaccaggccatgcagatggttcgcgccgggttgaaggcg
atctacctttccggctggcaggttgcagcagacgccaacacggcatcagccatgtatccc
gaccagtcgctctatccggccaatgccgggccagagcttgcaaagcgcatcaaccgcacg
ctgcaacgcgccgaccagatcgaaaccgccgaaggcaaggggctttcggttgacacatgg
ttcgcgcccatcgtggcggatgccgaggcaggctttggcggcccgctggatgccttcgag
atcatgaaagcctatatcgaggccggtgctgcgggcgttcactttgaagaccagcttgct
tcggaaaagaagtgcggccatctgggcggcaaggttctgatcccgaccgcagcgcacatc
cgcaacctcaacgcggcacgccttgcagccgacgtcatgggcacgccgaccctcatcgtg
gcgcgcacggatgcggaagcagccaagcttctgacgtcggatatcgacgagcgcgaccag
cctttcgtcgattacgaagcaggccgcacggcggaaggcttctatcaggtgaagaatggc
atcgagccatgcatcgcccgtgcgattgcctatgcgccttattgcgatctgatctggatg
gaaacgtccaagcctgatctcgcacaggcccgtcgcttcgcggaagccgtgcacaaggcg
catccgggcaagctgctcgcctataactgctcgccgtcgttcaactggaaaaagaacctc
gacgacgcgacgattgccaagttccagcgcgagctgggcgcgatgggctacaagttccag
ttcatcacgctggctggcttccaccagctcaactacggcatgttcgagctggcacgcggc
tacaaggatcgtcagatggcggcttattccgagctgcaacaggcggaatttgcagccgaa
gccgatggctacacggcaaccaagcaccagcgcgaagtcggcaccggctatttcgatgcc
gtgtcgctcgcaatcaccggcggccagtcttcgaccaccgccatgaaggaatcgaccgaa
accgcacagttcaagccggctgccgagtag

DBGET integrated database retrieval system