KEGG   Brucella abortus 9-941: BruAb1_1636Help
Entry
BruAb1_1636       CDS       T00241                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bmb  Brucella abortus 9-941
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BruAb1_1636 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BruAb1_1636 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BruAb1_1636 (glcB)
Enzymes [BR:bmb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BruAb1_1636 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1614970..1617156
Genome map
AA seq 728 aa AA seqDB search
MGSAEKRNYVEIEGLAVAPELVEFLAKEAAPGTGVEPEKFWKGFAAIIRDLTPKNRALLA
KRDELQARIDAWYKENRDKGYSQADYQQFLKDIGYLLPEGGAFSVSTTNVDPEITHIAGP
QLVVPVMNARYALNAANARWGSLYDALYGTDAISEADGAEKGKGYNPKRGEKVIAWAKNF
LDESAPLSTGKWADVAGLAVNDGKLEIRLTDGSATTLKDESQFKGYNGDAASPTNVLLAK
HNMHVDIVINADHPIGKTDPAHIADVVLESAISTIQDCEDSIAVVDAEDKVAVYRNWLGL
MNGKLEDTFEKNGKQMTRRLNGDRTYTAPDGSTLTLKGRSLMLVRNVGHLMTNPAILDAE
GNEVPEGIMDAAFTSLIALHDIGPNGRHMNSREGSVYIVKPKMHGPEEVAFANEIFTRTE
EMLGMKPNTLKIGIMDEERRTTVNLKEAIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPM
IRKGDMKQAAWIGAYEQWNVDIGLECGLSGHAQIGKGMWAMPDMMAAMLEQKIAHPKAGA
NTAWVPSPTAATLHATHYHKIDVAAVQEKLKSRPRAKLDDILSVPVAVRPNWTPDDIQHE
IDNNAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISAQHIANWLYHGVVSEAQ
VMETMKRMAAIVDKQNEGDPLYRPMAADFDKSIAFQAACDLVFKGREQPNGYTEPVLHRR
RLELKQAS
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcgcagaaaaacgtaactatgtcgagattgaaggcttggctgttgcccctgag
cttgtggaatttctggccaaagaagccgcgcccggcacaggcgtggagccggagaaattc
tggaagggctttgccgccatcattcgcgatctcacaccaaagaaccgcgccctgctcgcc
aagcgtgacgagcttcaggccaggatcgacgcctggtacaaggaaaaccgcgacaagggc
tacagccaggccgattaccagcagtttctgaaagatatcggctatctcctgccggaaggt
ggagcgttttcggtttcgaccaccaatgtcgatcctgaaatcacccatattgccggtccg
cagcttgtcgtcccggtcatgaatgcgcgctatgcactcaacgccgccaatgcgcgctgg
ggctcgctctatgatgcgctttatggcaccgacgcgatttccgaggccgatggcgcggaa
aagggcaagggctacaatccgaagcgcggtgaaaaggttattgcgtgggcgaagaatttc
ctcgatgaaagcgcaccgctcagcacgggcaaatgggccgatgttgccggtctcgccgtg
aacgacggcaagcttgaaatcaggctgaccgatggttcggcaaccaccttgaaggacgaa
agccagttcaagggctataatggcgatgccgccagcccaacgaatgtgcttcttgccaag
cacaatatgcatgttgatatcgtcatcaatgcagatcacccgatcggcaagaccgatccg
gcgcatattgccgatgtggttctggaatcggccatcagcacgatccaggattgtgaggac
tccattgccgtcgtcgatgccgaagacaaggttgccgtctatcgcaactggctcggcctg
atgaatggcaagctggaagacacgttcgagaagaacggcaagcagatgacgcgccgcctc
aatggcgaccgcacctacacggcgccggacggttccacgctgacgctcaagggccgttcc
ttgatgctggtgcgcaatgtcggccacctgatgaccaacccggccattctggacgccgaa
ggcaatgaagtgccggaaggcatcatggatgcagccttcaccagcctgattgcgctgcat
gatatcggccccaatggccgccacatgaattcgcgcgaaggctcggtctatatcgtcaag
ccaaaaatgcatgggccggaagaagtggcattcgcaaatgaaatcttcacccggaccgaa
gaaatgctcggcatgaagccgaatacgctcaaaatcggcatcatggacgaagaacgccgc
acgaccgtcaatctcaaggaggcaatccgcgccgccaaggatcgcgtcgtcttcatcaat
accggcttcctcgaccgcacgggcgacgagatccacacctccatggaagcaggcccgatg
atccgcaagggcgacatgaagcaggctgcgtggatcggcgcctatgaacaatggaatgtc
gatatcggtctggaatgcgggctttccggccatgcgcagatcggcaagggcatgtgggcc
atgcccgacatgatggcggcaatgctggagcagaagatcgcgcatccgaaggccggtgcg
aacaccgcctgggtgccgtcgccgaccgccgccaccttgcacgctacccattaccacaag
atcgatgtagccgccgttcaggaaaagctgaaaagccgtccccgcgccaagctggacgat
atcctgtcggtgccggttgcggtgcgtccgaactggacgccggacgatatccagcacgaa
atcgacaacaatgcacaaggcattctcggctatgtcgtgcgctggatcgatcagggtgtc
ggctgctccaaggtgccggacatcaacaatgtcggcctgatggaagatcgcgcgacgctg
cgcatttccgcgcagcacatcgccaactggctttatcatggcgtcgtgtcagaggcacag
gtgatggaaaccatgaagcgcatggcagccatcgtcgacaagcagaacgaaggcgacccg
ctttatcgcccgatggccgctgattttgacaagtcgattgccttccaggcggcttgcgat
ctggtcttcaagggccgcgaacagccgaacggctacaccgagccggtcctgcatcgccgc
cggctcgaactgaaacaggcttcctga

DBGET integrated database retrieval system